PDB entry 5hke

View 5hke on RCSB PDB site
Description: bile salt hydrolase from Lactobacillus salivarius
Class: hydrolase
Keywords: conjugated bile salt acid hydrolase, NTN-HYDROLASE, BILE ACIDS, HYDROLASE, CBAH, BSH
Deposited on 2016-01-14, released 2016-05-11
The last revision prior to the SCOPe 2.07 freeze date was dated 2016-05-11, with a file datestamp of 2016-05-06.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: N/A
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Bile salt hydrolase
    Species: Lactobacillus salivarius [TaxId:1624]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5hkea_
  • Chain 'B':
    Compound: Bile salt hydrolase
    Species: Lactobacillus salivarius [TaxId:1624]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5hkeb_
  • Heterogens: PO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5hkeA (A:)
    mctaitlngnsnyfgrnldldfsygeeviitpaeyefkfrkekaiknhksligvgivand
    yplyfdainedglgmaglnfpgnayysdalendkdnitpfefipwilgqcsdvnearnlv
    ekinlinlsfseqlplaglhwliadreksivvevtksgvhiydnpigiltnnpefnyqmy
    nlnkyrnlsistpqntfsdsvdlkvdgtgfggiglpgdvspesrfvratfsklnsskgmt
    veeditqffhilgtveqikgvnktesgkeeytvysncydldnktlyyttyenrqivavtl
    nkdkdgnrlvtypferkqiinklnlerhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5hkeA (A:)
    ctaitlngnsnyfgrnldldfsygeeviitpaeyefkfrkekaiknhksligvgivandy
    plyfdainedglgmaglnfpgnayysdalendkdnitpfefipwilgqcsdvnearnlve
    kinlinlsfseqlplaglhwliadreksivvevtksgvhiydnpigiltnnpefnyqmyn
    lnkyrnlsistpqntfsdsvdlkvdgtgfggiglpgdvspesrfvratfsklnsskgmtv
    eeditqffhilgtveqikgvnktesgkeeytvysncydldnktlyyttyenrqivavtlg
    nrlvtypferkqiinkl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5hkeB (B:)
    mctaitlngnsnyfgrnldldfsygeeviitpaeyefkfrkekaiknhksligvgivand
    yplyfdainedglgmaglnfpgnayysdalendkdnitpfefipwilgqcsdvnearnlv
    ekinlinlsfseqlplaglhwliadreksivvevtksgvhiydnpigiltnnpefnyqmy
    nlnkyrnlsistpqntfsdsvdlkvdgtgfggiglpgdvspesrfvratfsklnsskgmt
    veeditqffhilgtveqikgvnktesgkeeytvysncydldnktlyyttyenrqivavtl
    nkdkdgnrlvtypferkqiinklnlerhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5hkeB (B:)
    ctaitlngnsnyfgrnldldfsygeeviitpaeyefkfrkekaiknhksligvgivandy
    plyfdainedglgmaglnfpgnayysdalendkdnitpfefipwilgqcsdvnearnlve
    kinlinlsfseqlplaglhwliadreksivvevtksgvhiydnpigiltnnpefnyqmyn
    lnkyrnlsistpqntfsdsvdlkvdgtgfggiglpgdvspesrfvratfsklnsskgmtv
    eeditqffhilgtveqikgvnktesgkeeytvysncydldnktlyyttyenrqivavtlg
    nrlvtypferkqiinkl