PDB entry 5hkc

View 5hkc on RCSB PDB site
Description: crystal structure of m. tuberculosis mazf-mt3 t52d-f62d mutant in complex with 8-mer rna
Deposited on 2016-01-14, released 2017-01-18
The last revision was dated 2017-01-18, with a file datestamp of 2017-01-13.
Experiment type: XRAY
Resolution: 1.68 Å
R-factor: N/A
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Endoribonuclease MazF6
    Species: Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) [TaxId:83331]
    Gene: mazF6, MT2046
    Database cross-references and differences (RAF-indexed):
    • Uniprot P9WII2 (0-113)
      • engineered mutation (51)
      • engineered mutation (61)
  • Chain 'B':
    Compound: Endoribonuclease MazF6
    Species: Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) [TaxId:83331]
    Gene: mazF6, MT2046
    Database cross-references and differences (RAF-indexed):
    • Uniprot P9WII2 (Start-113)
      • engineered mutation (51)
      • engineered mutation (61)
  • Chain 'C':
    Compound: RNA (5'-r(*gp*up*c)-d(p*u)-r(p*cp*cp*up*a)-3')
    Species: MYCOBACTERIUM TUBERCULOSIS, synthetic [TaxId:1773]
  • Heterogens: HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >5hkcA (A:)
    mvisraeiywadlgppsgsqpakrrpvlviqsdpynasrlatviaavitsndalaampgn
    vdlpatttrlprdsvvnvtaivtlnktdltdrvgevpaslmhevdrglrrvldl
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >5hkcB (B:)
    mvisraeiywadlgppsgsqpakrrpvlviqsdpynasrlatviaavitsndalaampgn
    vdlpatttrlprdsvvnvtaivtlnktdltdrvgevpaslmhevdrglrrvldl
    

    Sequence, based on observed residues (ATOM records):
    >5hkcB (B:)
    visraeiywadlppsgsqpakrrpvlviqsdpynasrlatviaavitsndalaampgnvd
    lpatttrlprdsvvnvtaivtlnktdltdrvgevpaslmhevdrglrrvldl
    

  • Chain 'C':
    No sequence available.