PDB entry 5hk8

View 5hk8 on RCSB PDB site
Description: Crystal strucutre of a methylesterase protein MES16 from Arabidopsis
Class: hydrolase
Keywords: methylesterase protein, MES16, hydrolase superfamily, HYDROLASE
Deposited on 2016-01-13, released 2016-05-04
The last revision prior to the SCOPe 2.07 freeze date was dated 2016-05-04, with a file datestamp of 2016-04-29.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: N/A
AEROSPACI score: 0.17 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Probable pheophorbidase
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene: PPD, MES16, At4g16690, dl4370c, FCAALL.12
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5hk8a_
  • Chain 'B':
    Compound: Probable pheophorbidase
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene: PPD, MES16, At4g16690, dl4370c, FCAALL.12
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5hk8b_
  • Chain 'C':
    Compound: Probable pheophorbidase
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene: PPD, MES16, At4g16690, dl4370c, FCAALL.12
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5hk8c_
  • Chain 'D':
    Compound: Probable pheophorbidase
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene: PPD, MES16, At4g16690, dl4370c, FCAALL.12
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5hk8d_
  • Chain 'E':
    Compound: Probable pheophorbidase
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene: PPD, MES16, At4g16690, dl4370c, FCAALL.12
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5hk8e_
  • Chain 'F':
    Compound: Probable pheophorbidase
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene: PPD, MES16, At4g16690, dl4370c, FCAALL.12
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5hk8f_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5hk8A (A:)
    mgsshhhhhhssglvprgshmasmtggqqmgrgsefmggeggaepvihfvfvhgashgaw
    cwyklttlldaagfkstsvdltgagislidsnivfdsdqynrplfsllsdlpphhkvilv
    ghsigggsvtealckftdkismaiylaasmvqpgsipsphlsnihvgeediweytygegt
    dkpptgvlmkpefirhyyysqspledvtlsskllrpapmrafqdldklppnpeaekvprv
    yiktakdnlfdsvrqdllvenwppsqlyvledsdhsaffsvpttlfayllravsflqr
    

    Sequence, based on observed residues (ATOM records): (download)
    >5hk8A (A:)
    vihfvfvhgashgawcwyklttlldaagfkstsvdltgagislidsnivfdsdqynrplf
    sllsdlpphhkvilvghsigggsvtealckftdkismaiylaasmvqpgsiweytygegt
    dkpptgvlmkpefirhyyysqspledvtlsskllrpapmrafqdldklppnpeaekvprv
    yiktakdnlfdsvrqdllvenwppsqlyvledsdhsaffsvpttlfayllravsfl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5hk8B (B:)
    mgsshhhhhhssglvprgshmasmtggqqmgrgsefmggeggaepvihfvfvhgashgaw
    cwyklttlldaagfkstsvdltgagislidsnivfdsdqynrplfsllsdlpphhkvilv
    ghsigggsvtealckftdkismaiylaasmvqpgsipsphlsnihvgeediweytygegt
    dkpptgvlmkpefirhyyysqspledvtlsskllrpapmrafqdldklppnpeaekvprv
    yiktakdnlfdsvrqdllvenwppsqlyvledsdhsaffsvpttlfayllravsflqr
    

    Sequence, based on observed residues (ATOM records): (download)
    >5hk8B (B:)
    vihfvfvhgashgawcwyklttlldaagfkstsvdltgagislidsnivfdsdqynrplf
    sllsdlpphhkvilvghsigggsvtealckftdkismaiylaasmvqpgsiweytygegt
    dkpptgvlmkpefirhyyysqspledvtlsskllrpapmrafqdldklppnpeaekvprv
    yiktakdnlfdsvrqdllvenwppsqlyvledsdhsaffsvpttlfayllravsfl
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5hk8C (C:)
    mgsshhhhhhssglvprgshmasmtggqqmgrgsefmggeggaepvihfvfvhgashgaw
    cwyklttlldaagfkstsvdltgagislidsnivfdsdqynrplfsllsdlpphhkvilv
    ghsigggsvtealckftdkismaiylaasmvqpgsipsphlsnihvgeediweytygegt
    dkpptgvlmkpefirhyyysqspledvtlsskllrpapmrafqdldklppnpeaekvprv
    yiktakdnlfdsvrqdllvenwppsqlyvledsdhsaffsvpttlfayllravsflqr
    

    Sequence, based on observed residues (ATOM records): (download)
    >5hk8C (C:)
    vihfvfvhgashgawcwyklttlldaagfkstsvdltgagislidsnivfdsdqynrplf
    sllsdlpphhkvilvghsigggsvtealckftdkismaiylaasmvqpgsiweytygegt
    dkpptgvlmkpefirhyyysqspledvtlsskllrpapmrafqdldklppnpeaekvprv
    yiktakdnlfdsvrqdllvenwppsqlyvledsdhsaffsvpttlfayllravsfl
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5hk8D (D:)
    mgsshhhhhhssglvprgshmasmtggqqmgrgsefmggeggaepvihfvfvhgashgaw
    cwyklttlldaagfkstsvdltgagislidsnivfdsdqynrplfsllsdlpphhkvilv
    ghsigggsvtealckftdkismaiylaasmvqpgsipsphlsnihvgeediweytygegt
    dkpptgvlmkpefirhyyysqspledvtlsskllrpapmrafqdldklppnpeaekvprv
    yiktakdnlfdsvrqdllvenwppsqlyvledsdhsaffsvpttlfayllravsflqr
    

    Sequence, based on observed residues (ATOM records): (download)
    >5hk8D (D:)
    vihfvfvhgashgawcwyklttlldaagfkstsvdltgagislidsnivfdsdqynrplf
    sllsdlpphhkvilvghsigggsvtealckftdkismaiylaasmvqpgsiweytygegt
    dkpptgvlmkpefirhyyysqspledvtlsskllrpapmrafqdldklppnpeaekvprv
    yiktakdnlfdsvrqdllvenwppsqlyvledsdhsaffsvpttlfayllravsfl
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >5hk8E (E:)
    mgsshhhhhhssglvprgshmasmtggqqmgrgsefmggeggaepvihfvfvhgashgaw
    cwyklttlldaagfkstsvdltgagislidsnivfdsdqynrplfsllsdlpphhkvilv
    ghsigggsvtealckftdkismaiylaasmvqpgsipsphlsnihvgeediweytygegt
    dkpptgvlmkpefirhyyysqspledvtlsskllrpapmrafqdldklppnpeaekvprv
    yiktakdnlfdsvrqdllvenwppsqlyvledsdhsaffsvpttlfayllravsflqr
    

    Sequence, based on observed residues (ATOM records): (download)
    >5hk8E (E:)
    vihfvfvhgashgawcwyklttlldaagfkstsvdltgagislidsnivfdsdqynrplf
    sllsdlpphhkvilvghsigggsvtealckftdkismaiylaasmvqpgsiweytygegt
    dkpptgvlmkpefirhyyysqspledvtlsskllrpapmrafqdldklppnpeaekvprv
    yiktakdnlfdsvrqdllvenwppsqlyvledsdhsaffsvpttlfayllravsfl
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >5hk8F (F:)
    mgsshhhhhhssglvprgshmasmtggqqmgrgsefmggeggaepvihfvfvhgashgaw
    cwyklttlldaagfkstsvdltgagislidsnivfdsdqynrplfsllsdlpphhkvilv
    ghsigggsvtealckftdkismaiylaasmvqpgsipsphlsnihvgeediweytygegt
    dkpptgvlmkpefirhyyysqspledvtlsskllrpapmrafqdldklppnpeaekvprv
    yiktakdnlfdsvrqdllvenwppsqlyvledsdhsaffsvpttlfayllravsflqr
    

    Sequence, based on observed residues (ATOM records): (download)
    >5hk8F (F:)
    vihfvfvhgashgawcwyklttlldaagfkstsvdltgagislidsnivfdsdqynrplf
    sllsdlpphhkvilvghsigggsvtealckftdkismaiylaasmvqpgsiweytygegt
    dkpptgvlmkpefirhyyysqspledvtlsskllrpapmrafqdldklppnpeaekvprv
    yiktakdnlfdsvrqdllvenwppsqlyvledsdhsaffsvpttlfayllravsfl