PDB entry 5hk1

View 5hk1 on RCSB PDB site
Description: human sigma-1 receptor bound to pd144418
Deposited on 2016-01-13, released 2016-04-06
The last revision was dated 2016-05-11, with a file datestamp of 2016-05-06.
Experiment type: XRAY
Resolution: 2.51 Å
R-factor: N/A
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Sigma non-opioid intracellular receptor 1
    Species: Homo sapiens [TaxId:9606]
    Gene: SIGMAR1, OPRS1, SRBP, AAG8
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: Sigma non-opioid intracellular receptor 1
    Species: Homo sapiens [TaxId:9606]
    Gene: SIGMAR1, OPRS1, SRBP, AAG8
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: Sigma non-opioid intracellular receptor 1
    Species: Homo sapiens [TaxId:9606]
    Gene: SIGMAR1, OPRS1, SRBP, AAG8
    Database cross-references and differences (RAF-indexed):
  • Heterogens: 61W, SO4, OLC, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >5hk1A (A:)
    gpgsmqwavgrrwawaalllavaavltqvvwlwlgtqsfvfqreeiaqlarqyagldhel
    afsrlivelrrlhpghvlpdeelqwvfvnaggwmgamcllhaslseyvllfgtalgsrgh
    sgrywaeisdtiisgtfhqwregttksevfypgetvvhgpgeatavewgpntwmveygrg
    vipstlafaladtvfstqdfltlfytlrsyarglrlelttylfgqdp
    

    Sequence, based on observed residues (ATOM records):
    >5hk1A (A:)
    rwawaalllavaavltqvvwlwlgtqsfvfqreeiaqlarqyagldhelafsrlivelrr
    lhpghvlpdeelqwvfvnaggwmgamcllhaslseyvllfgtalgsrghsgrywaeisdt
    iisgtfhqwregttksevfypgetvvhgpgeatavewgpntwmveygrgvipstlafala
    dtvfstqdfltlfytlrsyarglrlelttylf
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >5hk1B (B:)
    gpgsmqwavgrrwawaalllavaavltqvvwlwlgtqsfvfqreeiaqlarqyagldhel
    afsrlivelrrlhpghvlpdeelqwvfvnaggwmgamcllhaslseyvllfgtalgsrgh
    sgrywaeisdtiisgtfhqwregttksevfypgetvvhgpgeatavewgpntwmveygrg
    vipstlafaladtvfstqdfltlfytlrsyarglrlelttylfgqdp
    

    Sequence, based on observed residues (ATOM records):
    >5hk1B (B:)
    mqwavgrrwawaalllavaavltqvvwlwlgtqsfvfqreeiaqlarqyagldhelafsr
    livelrrlhpghvlpdeelqwvfvnaggwmgamcllhaslseyvllfgtalgsrghsgry
    waeisdtiisgtfhqwregttksevfypgetvvhgpgeatavewgpntwmveygrgvips
    tlafaladtvfstqdfltlfytlrsyarglrlelttylf
    

  • Chain 'C':
    Sequence, based on SEQRES records:
    >5hk1C (C:)
    gpgsmqwavgrrwawaalllavaavltqvvwlwlgtqsfvfqreeiaqlarqyagldhel
    afsrlivelrrlhpghvlpdeelqwvfvnaggwmgamcllhaslseyvllfgtalgsrgh
    sgrywaeisdtiisgtfhqwregttksevfypgetvvhgpgeatavewgpntwmveygrg
    vipstlafaladtvfstqdfltlfytlrsyarglrlelttylfgqdp
    

    Sequence, based on observed residues (ATOM records):
    >5hk1C (C:)
    qwavgrrwawaalllavaavltqvvwlwlgtqsfvfqreeiaqlarqyagldhelafsrl
    ivelrrlhpghvlpdeelqwvfvnaggwmgamcllhaslseyvllfgtalgsrghsgryw
    aeisdtiisgtfhqwregttksevfypgetvvhgpgeatavewgpntwmveygrgvipst
    lafaladtvfstqdfltlfytlrsyarglrlelttylfg