PDB entry 5hji

View 5hji on RCSB PDB site
Description: crystal structure of pyrococcus abyssi trm5a complexed with adenosine
Deposited on 2016-01-13, released 2016-10-12
The last revision was dated 2016-10-12, with a file datestamp of 2016-10-07.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: N/A
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: tRNA (guanine(37)-N1)-methyltransferase Trm5a
    Species: Pyrococcus abyssi (strain GE5 / Orsay) [TaxId:272844]
    Gene: trm5a, PYRAB01130, PAB2272
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9V2G1 (19-351)
      • expression tag (3-18)
  • Heterogens: ADN, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >5hjiA (A:)
    mgsshhhhhhlevlfqgphmsgvkvrredakkvlellksvgildgkrkairdekyvifpv
    tdtniakslglevvdvelpmrperqiyknledllpreifkklgrldivgdiaivsipdei
    lserevivsairklypkvkviarrgfhsglyrireleviwgenrlhtihkengvlikvdl
    skvffnprmkgeryriaqlvndgerilvpfagvipyplviarfknvevyaveinefavkl
    aeenlelnrdrlkgkikiihgdvfevlpnlpnfdrvvsptpkgvdalsltlskaekflhy
    ydfvheseierfrervleecrrqgkecrvsvrkvsdykphvykvcadveils
    

    Sequence, based on observed residues (ATOM records):
    >5hjiA (A:)
    shhhhhhlevlfqgphmsgvkvrredakkvlellksvgildgkrkairdekyvifpvtdt
    niakslglevvdvelpmrperqiyknledllpreifkklgrldivgdiaivsipdeilse
    revivsairklypkvkviarrgfhsglyrireleviwgenrlhtihkengvlikvdlskv
    ffnprmkgeryriaqlvndgerilvpfagvipyplviarfknvevyaveinefavklaee
    nlelnrdrlkgkikiihgdvfevlpnlpnfdrvvsptpkgvdalsltlskaekflhyydf
    vheseierfrervleecrrqgkecrvsvrkvsdykphvykvcadveils