PDB entry 5hjh

View 5hjh on RCSB PDB site
Description: Dps4 from Nostoc punctiforme in complex with Fe ions
Class: metal binding protein
Keywords: metal binding, ferredoxin, oxidative stress, metal binding protein
Deposited on 2016-01-13, released 2017-01-25
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-09-13, with a file datestamp of 2017-09-08.
Experiment type: XRAY
Resolution: 1.88 Å
R-factor: N/A
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ferritin, Dps family protein
    Species: Nostoc punctiforme [TaxId:272131]
    Gene: Npun_R5799
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5hjha_
  • Chain 'B':
    Compound: Ferritin, Dps family protein
    Species: Nostoc punctiforme [TaxId:272131]
    Gene: Npun_R5799
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5hjhb_
  • Chain 'C':
    Compound: Ferritin, Dps family protein
    Species: Nostoc punctiforme [TaxId:272131]
    Gene: Npun_R5799
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5hjhc_
  • Chain 'D':
    Compound: Ferritin, Dps family protein
    Species: Nostoc punctiforme [TaxId:272131]
    Gene: Npun_R5799
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5hjhd_
  • Heterogens: FE, EPE, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5hjhA (A:)
    qtllrnfgnvydnpvlldrsvtapvtegfnvvlasfqalylqyqkhhfvvegsefyslhe
    ffnesynqvqdhiheigerldglggvpvatfsklaeltcfeqesegvyssrqmvendlaa
    eqaiigvirrqaaqaeslgdrgtrylyekillkteerayhlshflakdsltlgfvqaa
    

    Sequence, based on observed residues (ATOM records): (download)
    >5hjhA (A:)
    tllrnfgnvydnpvlldrsvtapvtegfnvvlasfqalylqyqkhhfvvegsefyslhef
    fnesynqvqdhiheigerldglggvpvatfsklaeltcfeqesegvyssrqmvendlaae
    qaiigvirrqaaqaeslgdrgtrylyekillkteerayhlshflakdsltlgfvqaa
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5hjhB (B:)
    qtllrnfgnvydnpvlldrsvtapvtegfnvvlasfqalylqyqkhhfvvegsefyslhe
    ffnesynqvqdhiheigerldglggvpvatfsklaeltcfeqesegvyssrqmvendlaa
    eqaiigvirrqaaqaeslgdrgtrylyekillkteerayhlshflakdsltlgfvqaa
    

    Sequence, based on observed residues (ATOM records): (download)
    >5hjhB (B:)
    tllrnfgnvydnpvlldrsvtapvtegfnvvlasfqalylqyqkhhfvvegsefyslhef
    fnesynqvqdhiheigerldglggvpvatfsklaeltcfeqesegvyssrqmvendlaae
    qaiigvirrqaaqaeslgdrgtrylyekillkteerayhlshflakdsltlgfvqaa
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5hjhC (C:)
    qtllrnfgnvydnpvlldrsvtapvtegfnvvlasfqalylqyqkhhfvvegsefyslhe
    ffnesynqvqdhiheigerldglggvpvatfsklaeltcfeqesegvyssrqmvendlaa
    eqaiigvirrqaaqaeslgdrgtrylyekillkteerayhlshflakdsltlgfvqaa
    

    Sequence, based on observed residues (ATOM records): (download)
    >5hjhC (C:)
    tllrnfgnvydnpvlldrsvtapvtegfnvvlasfqalylqyqkhhfvvegsefyslhef
    fnesynqvqdhiheigerldglggvpvatfsklaeltcfeqesegvyssrqmvendlaae
    qaiigvirrqaaqaeslgdrgtrylyekillkteerayhlshflakdsltlgfvqaa
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5hjhD (D:)
    qtllrnfgnvydnpvlldrsvtapvtegfnvvlasfqalylqyqkhhfvvegsefyslhe
    ffnesynqvqdhiheigerldglggvpvatfsklaeltcfeqesegvyssrqmvendlaa
    eqaiigvirrqaaqaeslgdrgtrylyekillkteerayhlshflakdsltlgfvqaa