PDB entry 5hja

View 5hja on RCSB PDB site
Description: Crystal structure of Leishmania mexicana arginase in complex with inhibitor ABHDP
Class: hydrolase
Keywords: hydrolase
Deposited on 2016-01-13, released 2016-04-13
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-09-13, with a file datestamp of 2017-09-08.
Experiment type: XRAY
Resolution: 1.65 Å
R-factor: N/A
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: arginase
    Species: Leishmania mexicana [TaxId:5665]
    Gene: ARG
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5hjaa_
  • Heterogens: MN, XA2, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5hjaA (A:)
    mrgshhhhhhgmakkmsivlapfsggqphsgvelgpdyllkqglqqdmeklgwdtrlerv
    fdgkvvearkasdngdrigrvkrprltaectekiykcvrrvaeqgrfpltiggdhsialg
    tvagvlsvhpdagviwvdahadintmsgtvsgnlhgcplsillgldrenipecfswvpqv
    lkpnkiayiglravddeekkilhdlniaafsmhhvdrygidkvvsmaieavspkgtepvm
    vsydvdtidplyvpatgtpvrgglsfrealflceriaecgrlvaldvvecnpllaatesh
    vndtisvgcaiarcmmgetllytphtsskl
    

    Sequence, based on observed residues (ATOM records): (download)
    >5hjaA (A:)
    kkmsivlapfsggqphsgvelgpdyllkqglqqdmeklgwdtrlervfdgkvvearkasd
    ngdrigrvkrprltaectekiykcvrrvaeqgrfpltiggdhsialgtvagvlsvhpdag
    viwvdahadintmsgtvsgnlhgcplsillgldrenipecfswvpqvlkpnkiayiglra
    vddeekkilhdlniaafsmhhvdrygidkvvsmaieavspkgtepvmvsydvdtidplyv
    patgtpvrgglsfrealflceriaecgrlvaldvvecnpllndtisvgcaiarcmmgetl
    lyt