PDB entry 5hj5

View 5hj5 on RCSB PDB site
Description: Crystal structure of tertiary complex of glucosamine-6-phosphate deaminase from Vibrio cholerae with BETA-D-GLUCOSE-6-PHOSPHATE and FRUCTOSE-6-PHOSPHATE
Class: hydrolase
Keywords: Structural Genomics, Center for Structural Genomics of Infectious Diseases, CSGID, glucosamine-6-phosphate deaminase, Vibrio cholerae, HYDROLASE
Deposited on 2016-01-12, released 2016-02-03
The last revision prior to the SCOPe 2.07 freeze date was dated 2016-02-03, with a file datestamp of 2016-01-29.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: N/A
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: glucosamine-6-phosphate deaminase
    Species: Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) [TaxId:243277]
    Gene: nagB, VC_A1025
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5hj5a_
  • Chain 'B':
    Compound: glucosamine-6-phosphate deaminase
    Species: Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) [TaxId:243277]
    Gene: nagB, VC_A1025
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9KKS5 (0-265)
      • expression tag (266)
    Domains in SCOPe 2.07: d5hj5b1, d5hj5b2
  • Chain 'C':
    Compound: glucosamine-6-phosphate deaminase
    Species: Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) [TaxId:243277]
    Gene: nagB, VC_A1025
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5hj5c_
  • Chain 'D':
    Compound: glucosamine-6-phosphate deaminase
    Species: Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) [TaxId:243277]
    Gene: nagB, VC_A1025
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5hj5d_
  • Heterogens: F6R, BG6, GOL, ACY, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5hj5A (A:)
    mrliplkaaaqvgkwaaahivkrinefqptaerpfvlglptggtplatykaliemhkage
    vsfkhvvtfnmdeyvglaadhpesyrsfmynnffnhidiqeeninllngntddheaeckr
    yedkiksygkinlfmggvgndghiafnepasslssrtriktltedtriansrffdgdinq
    vpkyaltigvgtlldaqeimilvtghnkalalqaavegsvnhlwtvsalqlhpkavivcd
    epstqelkvktvkyfteleaknivgfr
    

    Sequence, based on observed residues (ATOM records): (download)
    >5hj5A (A:)
    mrliplkaaaqvgkwaaahivkrinefqptaerpfvlglptggtplatykaliemhkage
    vsfkhvvtfnmdeyvglaadhpesyrsfmynnffnhidiqeeninllngntddheaeckr
    yedkiksygkinlfmggvgndghiafnepasslssrtriktltedtriansrffdgdinq
    vpkyaltigvgtlldaqeimilvtghnkalalqaavegsvnhlwtvsalqlhpkavivcd
    epstqelkvktvkyfteleaknivgf
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5hj5B (B:)
    mrliplkaaaqvgkwaaahivkrinefqptaerpfvlglptggtplatykaliemhkage
    vsfkhvvtfnmdeyvglaadhpesyrsfmynnffnhidiqeeninllngntddheaeckr
    yedkiksygkinlfmggvgndghiafnepasslssrtriktltedtriansrffdgdinq
    vpkyaltigvgtlldaqeimilvtghnkalalqaavegsvnhlwtvsalqlhpkavivcd
    epstqelkvktvkyfteleaknivgfr
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5hj5C (C:)
    mrliplkaaaqvgkwaaahivkrinefqptaerpfvlglptggtplatykaliemhkage
    vsfkhvvtfnmdeyvglaadhpesyrsfmynnffnhidiqeeninllngntddheaeckr
    yedkiksygkinlfmggvgndghiafnepasslssrtriktltedtriansrffdgdinq
    vpkyaltigvgtlldaqeimilvtghnkalalqaavegsvnhlwtvsalqlhpkavivcd
    epstqelkvktvkyfteleaknivgfr
    

    Sequence, based on observed residues (ATOM records): (download)
    >5hj5C (C:)
    mrliplkaaaqvgkwaaahivkrinefqptaerpfvlglptggtplatykaliemhkage
    vsfkhvvtfnmdeyvglaadhpesyrsfmynnffnhidiqeeninllngntddheaeckr
    yedkiksygkinlfmggvgndghiafnepasslssrtriktltedtriansrffdgdinq
    vpkyaltigvgtlldaqeimilvtghnkalalqaavegsvnhlwtvsalqlhpkavivcd
    epstqelkvktvkyfteleaknivgf
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5hj5D (D:)
    mrliplkaaaqvgkwaaahivkrinefqptaerpfvlglptggtplatykaliemhkage
    vsfkhvvtfnmdeyvglaadhpesyrsfmynnffnhidiqeeninllngntddheaeckr
    yedkiksygkinlfmggvgndghiafnepasslssrtriktltedtriansrffdgdinq
    vpkyaltigvgtlldaqeimilvtghnkalalqaavegsvnhlwtvsalqlhpkavivcd
    epstqelkvktvkyfteleaknivgfr
    

    Sequence, based on observed residues (ATOM records): (download)
    >5hj5D (D:)
    mrliplkaaaqvgkwaaahivkrinefqptaerpfvlglptggtplatykaliemhkage
    vsfkhvvtfnmdeyvglaadhpesyrsfmynnffnhidiqeeninllngntddheaeckr
    yedkiksygkinlfmggvgndghiafnepasslssrtriktltedtriansrffdgdinq
    vpkyaltigvgtlldaqeimilvtghnkalalqaavegsvnhlwtvsalqlhpkavivcd
    epstqelkvktvkyfteleaknivgf