PDB entry 5hj2

View 5hj2 on RCSB PDB site
Description: Integrin alpha2beta1 I-domain
Class: cell adhesion
Keywords: Adhesion, signaling, CELL ADHESION
Deposited on 2016-01-12, released 2017-04-12
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-04-12, with a file datestamp of 2017-04-07.
Experiment type: XRAY
Resolution: 2.15 Å
R-factor: N/A
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Integrin alpha-2
    Species: Homo sapiens [TaxId:9606]
    Gene: ITGA2, CD49B
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5hj2a_
  • Chain 'B':
    Compound: Integrin alpha-2
    Species: Homo sapiens [TaxId:9606]
    Gene: ITGA2, CD49B
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5hj2b_
  • Chain 'C':
    Compound: Integrin alpha-2
    Species: Homo sapiens [TaxId:9606]
    Gene: ITGA2, CD49B
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5hj2c_
  • Chain 'D':
    Compound: Integrin alpha-2
    Species: Homo sapiens [TaxId:9606]
    Gene: ITGA2, CD49B
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5hj2d_
  • Chain 'E':
    Compound: Integrin alpha-2
    Species: Homo sapiens [TaxId:9606]
    Gene: ITGA2, CD49B
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5hj2e_
  • Chain 'F':
    Compound: Integrin alpha-2
    Species: Homo sapiens [TaxId:9606]
    Gene: ITGA2, CD49B
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5hj2f_
  • Heterogens: CA, CL, PEG, SO4, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5hj2A (A:)
    pslidvvvvcdesnsiypwdavknflekfvqgldigptktqvgliqyannprvvfnlnty
    ktkeemivatsqtsqyggdltntfgaiqyarkyaysaasggrrsatkvmvvvtdgeshdg
    smlkavidqcnhdnilrfgiavlgylnrnaldtknlikeikaiasipteryffnvsdeaa
    llekagtlgeqifsieg
    

    Sequence, based on observed residues (ATOM records): (download)
    >5hj2A (A:)
    slidvvvvcdesnsiypwdavknflekfvqgldigptktqvgliqyannprvvfnlntyk
    tkeemivatsqtsqyggdltntfgaiqyarkyaysaasggrrsatkvmvvvtdgeshdgs
    mlkavidqcnhdnilrfgiavlgylnrnaldtknlikeikaiasipteryffnvsdeaal
    lekagtlgeqifsieg
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5hj2B (B:)
    pslidvvvvcdesnsiypwdavknflekfvqgldigptktqvgliqyannprvvfnlnty
    ktkeemivatsqtsqyggdltntfgaiqyarkyaysaasggrrsatkvmvvvtdgeshdg
    smlkavidqcnhdnilrfgiavlgylnrnaldtknlikeikaiasipteryffnvsdeaa
    llekagtlgeqifsieg
    

    Sequence, based on observed residues (ATOM records): (download)
    >5hj2B (B:)
    slidvvvvcdesnsiypwdavknflekfvqgldigptktqvgliqyannprvvfnlntyk
    tkeemivatsqtsqyggdltntfgaiqyarkyaysaasggrrsatkvmvvvtdgeshdgs
    mlkavidqcnhdnilrfgiavlgylnrnaldtknlikeikaiasipteryffnvsdeaal
    lekagtlgeqifsieg
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5hj2C (C:)
    pslidvvvvcdesnsiypwdavknflekfvqgldigptktqvgliqyannprvvfnlnty
    ktkeemivatsqtsqyggdltntfgaiqyarkyaysaasggrrsatkvmvvvtdgeshdg
    smlkavidqcnhdnilrfgiavlgylnrnaldtknlikeikaiasipteryffnvsdeaa
    llekagtlgeqifsieg
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5hj2D (D:)
    pslidvvvvcdesnsiypwdavknflekfvqgldigptktqvgliqyannprvvfnlnty
    ktkeemivatsqtsqyggdltntfgaiqyarkyaysaasggrrsatkvmvvvtdgeshdg
    smlkavidqcnhdnilrfgiavlgylnrnaldtknlikeikaiasipteryffnvsdeaa
    llekagtlgeqifsieg
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >5hj2E (E:)
    pslidvvvvcdesnsiypwdavknflekfvqgldigptktqvgliqyannprvvfnlnty
    ktkeemivatsqtsqyggdltntfgaiqyarkyaysaasggrrsatkvmvvvtdgeshdg
    smlkavidqcnhdnilrfgiavlgylnrnaldtknlikeikaiasipteryffnvsdeaa
    llekagtlgeqifsieg
    

    Sequence, based on observed residues (ATOM records): (download)
    >5hj2E (E:)
    slidvvvvcdesnsiypwdavknflekfvqgldigptktqvgliqyannprvvfnlntyk
    tkeemivatsqtsqyggdltntfgaiqyarkyaysaasggrrsatkvmvvvtdgeshdgs
    mlkavidqcnhdnilrfgiavlgylnrnaldtknlikeikaiasipteryffnvsdeaal
    lekagtlgeqifsieg
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >5hj2F (F:)
    pslidvvvvcdesnsiypwdavknflekfvqgldigptktqvgliqyannprvvfnlnty
    ktkeemivatsqtsqyggdltntfgaiqyarkyaysaasggrrsatkvmvvvtdgeshdg
    smlkavidqcnhdnilrfgiavlgylnrnaldtknlikeikaiasipteryffnvsdeaa
    llekagtlgeqifsieg
    

    Sequence, based on observed residues (ATOM records): (download)
    >5hj2F (F:)
    lidvvvvcdesnsiypwdavknflekfvqgldigptktqvgliqyannprvvfnlntykt
    keemivatsqtsqyggdltntfgaiqyarkyaysaasggrrsatkvmvvvtdgeshdgsm
    lkavidqcnhdnilrfgiavlgylnrnaldtknlikeikaiasipteryffnvsdeaall
    ekagtlgeqifsieg