PDB entry 5hic

View 5hic on RCSB PDB site
Description: EGFR kinase domain mutant "TMLR" with a imidazopyridinyl-aminopyrimidine inhibitor
Class: transferase/transferase inhibitor
Keywords: protein kinase, inhibitor, TRANSFERASE-TRANSFERASE INHIBITOR complex
Deposited on 2016-01-11, released 2016-04-06
The last revision prior to the SCOPe 2.07 freeze date was dated 2016-04-20, with a file datestamp of 2016-04-15.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: N/A
AEROSPACI score: 0.19 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Epidermal growth factor receptor
    Species: Homo sapiens [TaxId:9606]
    Gene: EGFR, ERBB, ERBB1, HER1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00533
      • engineered mutation (96)
      • engineered mutation (164)
    Domains in SCOPe 2.07: d5hica_
  • Heterogens: SO4, 63N, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5hicA (A:)
    gsgeapnqallrilketefkkikvlgsgafgtvykglwipegekvkipvaikelreatsp
    kankeildeayvmasvdnphvcrllgicltstvqlimqlmpfgclldyvrehkdnigsqy
    llnwcvqiakgmnyledrrlvhrdlaarnvlvktpqhvkitdfgrakllgaaaaeyhaeg
    gkvpikwmalesilhriythqsdvwsygvtvwelmtfgskpydgipaseissilekgerl
    pqppictidvymimvkcwmidadsrpkfreliiefskmardpqrylviqgdermhlpspt
    dsnfyralmdeedmddvvdadeylipqqgns
    

    Sequence, based on observed residues (ATOM records): (download)
    >5hicA (A:)
    eapnqallrilketefkkikvlgsgafgtvykglwipegekvkipvaikelatspkanke
    ildeayvmasvdnphvcrllgicltstvqlimqlmpfgclldyvrehkdnigsqyllnwc
    vqiakgmnyledrrlvhrdlaarnvlvktpqhvkitdfgraklvpikwmalesilhriyt
    hqsdvwsygvtvwelmtfgskpydgipaseissilekgerlpqppictidvymimvkcwm
    idadsrpkfreliiefskmardpqrylviqgdermhlpsptdsnfyeedmddvvdadeyl
    ip