PDB entry 5hhw

View 5hhw on RCSB PDB site
Description: Crystal structure of insulin receptor kinase domain in complex with cis-(R)-7-(3-(azetidin-1-ylmethyl)cyclobutyl)-5-(3-((tetrahydro-2H-pyran-2-yl)methoxy)phenyl)-7H-pyrrolo[2,3-d]pyrimidin-4-amine.
Class: transferase
Keywords: Inhibitor, Complex, Insulin receptor, Kinase, transferase
Deposited on 2016-01-11, released 2016-04-13
The last revision prior to the SCOPe 2.07 freeze date was dated 2016-04-13, with a file datestamp of 2016-04-08.
Experiment type: XRAY
Resolution: 1.79 Å
R-factor: N/A
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Insulin receptor
    Species: Homo sapiens [TaxId:9606]
    Gene: INSR
    Database cross-references and differences (RAF-indexed):
    • Uniprot P06213 (1-306)
      • engineered mutation (4)
      • engineered mutation (155)
    Domains in SCOPe 2.07: d5hhwa_
  • Heterogens: 60O, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5hhwA (A:)
    mvfpssvyvpdewevsrekitllrelgqgsfgmvyegnardiikgeaetrvavktvnesa
    slrerieflneasvmkgftchhvvrllgvvskgqptlvvmelmahgdlksylrslrpeae
    nnpgrppptlqemiqmaaeiadgmaylnakkfvhrnlaarncmvahdftvkigdfgmtrd
    iyetdyyrkggkgllpvrwmapeslkdgvfttssdmwsfgvvlweitslaeqpyqglsne
    qvlkfvmdggyldqpdncpervtdlmrmcwqfnpkmrptfleivnllkddlhpsfpevsf
    fhseenk
    

    Sequence, based on observed residues (ATOM records): (download)
    >5hhwA (A:)
    vfpssvyvpdewevsrekitllrelgqgsfgmvyegnardiikgeaetrvavktvnesas
    lrerieflneasvmkgftchhvvrllgvvskgqptlvvmelmahgdlksylrslrpeaen
    npgrppptlqemiqmaaeiadgmaylnakkfvhrnlaarncmvahdftvkigdfgmtrdi
    yetdyyrkggkgllpvrwmapeslkdgvfttssdmwsfgvvlweitslaeqpyqglsneq
    vlkfvmdggyldqpdncpervtdlmrmcwqfnpkmrptfleivnllkddlhpsfpevsff
    hseenk