PDB entry 5hht

View 5hht on RCSB PDB site
Description: Crystal structure of E. coli transketolase triple variant Ser385Tyr/Asp469Thr/Arg520Gln
Class: transferase
Keywords: thiamin diphosphate, transferase, engineered variant, pentose phosphate pathway
Deposited on 2016-01-11, released 2016-11-02
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-09-06, with a file datestamp of 2017-09-01.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: N/A
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Transketolase 1
    Species: Escherichia coli K-12 [TaxId:83333]
    Gene: tktA, tkt, b2935, JW5478
    Database cross-references and differences (RAF-indexed):
    • Uniprot P27302 (Start-662)
      • engineered mutation (384)
      • engineered mutation (468)
      • engineered mutation (519)
    Domains in SCOPe 2.07: d5hhta1, d5hhta2, d5hhta3
  • Chain 'B':
    Compound: Transketolase 1
    Species: Escherichia coli K-12 [TaxId:83333]
    Gene: tktA, tkt, b2935, JW5478
    Database cross-references and differences (RAF-indexed):
    • Uniprot P27302 (Start-662)
      • engineered mutation (384)
      • engineered mutation (468)
      • engineered mutation (519)
      • expression tag (663-667)
    Domains in SCOPe 2.07: d5hhtb1, d5hhtb2, d5hhtb3, d5hhtb4
  • Heterogens: EDO, CA, TDP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5hhtA (A:)
    mssrkelanairalsmdavqkaksghpgapmgmadiaevlwrdflkhnpqnpswadrdrf
    vlsnghgsmliysllhltgydlpmeelknfrqlhsktpghpevgytagvetttgplgqgi
    anavgmaiaektlaaqfnrpghdivdhytyafmgdgcmmegishevcslagtlklgklia
    fyddngisidghvegwftddtamrfeaygwhvirdidghdaasikraveearavtdkpsl
    lmcktiigfgspnkagthdshgaplgdaeialtreqlgwkyapfeipseiyaqwdakeag
    qakesawnekfaayakaypqeaaeftrrmkgempsdfdakakefiaklqanpakiasrka
    sqnaieafgpllpeflggsadlapynltlwsgskainedaagnyihygvrefgmtaiang
    islhggflpytstflmfveyarnavrmaalmkqrqvmvythdsiglgetgpthqpveqva
    slrvtpnmstwrpcdqvesavawkygverqdgptalilsqqnlaqqerteeqlaniargg
    yvlkdcagqpelifiatgsevelavaayekltaegvkarvvsmpstdafdkqdaayresv
    lpkavtarvaveagiadywykyvglngaivgmttfgesapaellfeefgftvdnvvakak
    ellhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5hhtA (A:)
    ssrkelanairalsmdavqkaksghpgapmgmadiaevlwrdflkhnpqnpswadrdrfv
    lsnghgsmliysllhltgydlpmeelknfrqlhsktpghpevgytagvetttgplgqgia
    navgmaiaektlaaqfnrpghdivdhytyafmgdgcmmegishevcslagtlklgkliaf
    yddngisidghvegwftddtamrfeaygwhvirdidghdaasikraveearavtdkpsll
    mcktiigfgspnkagthdshgaplgdaeialtreqlgwkyapfeipseiyaqwdakeagq
    akesawnekfaayakaypqeaaeftrrmkgempsdfdakakefiaklqanpakiasrkas
    qnaieafgpllpeflggsadlapynltlwsgskainedaagnyihygvrefgmtaiangi
    slhggflpytstflmfveyarnavrmaalmkqrqvmvythdsiglgetgpthqpveqvas
    lrvtpnmstwrpcdqvesavawkygverqdgptalilsqqnlaqqerteeqlaniarggy
    vlkdcagqpelifiatgsevelavaayekltaegvkarvvsmpstdafdkqdaayresvl
    pkavtarvaveagiadywykyvglngaivgmttfgesapaellfeefgftvdnvvakake
    ll
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5hhtB (B:)
    mssrkelanairalsmdavqkaksghpgapmgmadiaevlwrdflkhnpqnpswadrdrf
    vlsnghgsmliysllhltgydlpmeelknfrqlhsktpghpevgytagvetttgplgqgi
    anavgmaiaektlaaqfnrpghdivdhytyafmgdgcmmegishevcslagtlklgklia
    fyddngisidghvegwftddtamrfeaygwhvirdidghdaasikraveearavtdkpsl
    lmcktiigfgspnkagthdshgaplgdaeialtreqlgwkyapfeipseiyaqwdakeag
    qakesawnekfaayakaypqeaaeftrrmkgempsdfdakakefiaklqanpakiasrka
    sqnaieafgpllpeflggsadlapynltlwsgskainedaagnyihygvrefgmtaiang
    islhggflpytstflmfveyarnavrmaalmkqrqvmvythdsiglgetgpthqpveqva
    slrvtpnmstwrpcdqvesavawkygverqdgptalilsqqnlaqqerteeqlaniargg
    yvlkdcagqpelifiatgsevelavaayekltaegvkarvvsmpstdafdkqdaayresv
    lpkavtarvaveagiadywykyvglngaivgmttfgesapaellfeefgftvdnvvakak
    ellhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5hhtB (B:)
    ssrkelanairalsmdavqkaksghpgapmgmadiaevlwrdflkhnpqnpswadrdrfv
    lsnghgsmliysllhltgydlpmeelknfrqlhsktpghpevgytagvetttgplgqgia
    navgmaiaektlaaqfnrpghdivdhytyafmgdgcmmegishevcslagtlklgkliaf
    yddngisidghvegwftddtamrfeaygwhvirdidghdaasikraveearavtdkpsll
    mcktiigfgspnkagthdshgaplgdaeialtreqlgwkyapfeipseiyaqwdakeagq
    akesawnekfaayakaypqeaaeftrrmkgempsdfdakakefiaklqanpakiasrkas
    qnaieafgpllpeflggsadlapynltlwsgskainedaagnyihygvrefgmtaiangi
    slhggflpytstflmfveyarnavrmaalmkqrqvmvythdsiglgetgpthqpveqvas
    lrvtpnmstwrpcdqvesavawkygverqdgptalilsqqnlaqqerteeqlaniarggy
    vlkdcagqpelifiatgsevelavaayekltaegvkarvvsmpstdafdkqdaayresvl
    pkavtarvaveagiadywykyvglngaivgmttfgesapaellfeefgftvdnvvakake
    llhhhhh