PDB entry 5hha

View 5hha on RCSB PDB site
Description: structure of pvdo from pseudomonas aeruginosa
Deposited on 2016-01-10, released 2017-01-18
The last revision was dated 2017-01-25, with a file datestamp of 2017-01-20.
Experiment type: XRAY
Resolution: 1.24 Å
R-factor: N/A
AEROSPACI score: 0.62 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: PvdO
    Species: Pseudomonas aeruginosa [TaxId:208964]
    Gene: pvdO, PA2395
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: PvdO
    Species: Pseudomonas aeruginosa [TaxId:208964]
    Gene: pvdO, PA2395
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9I185 (Start-285)
      • expression tag (1-11)
  • Heterogens: CA, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >5hhaA (A:)
    mgsshhhhhhsqdlevlfqgpgsdeakkpgtvfkdckdcpemvvlpagsftmgtpddevg
    rqpdegplhdvtfakpfaisryqvtageldaylkatgvkladgdtrpgreciagkpryqq
    gprqpavcvdyndvknyaawlskktgkryrmlseaereygaragsagpfpfpfdegkeys
    iakhantygasdgynftspvgsfppnafgvydmhgnvyewvadcwhdhyngapsdgsawm
    eekcelvqirgndwgeppifsrsgnrnnaapsdrgdwigfrvarel
    

    Sequence, based on observed residues (ATOM records):
    >5hhaA (A:)
    akkpgtvfkdckdcpemvvlpagsftmgtpddevgrqpdegplhdvtfakpfaisryqvt
    ageldaylkatgvkladgdtrpgreciagkpryqqgprqpavcvdyndvknyaawlskkt
    gkryrmlseaereygaragsagpfpfpfdegkeysiakhantygasdgynftspvgsfpp
    nafgvydmhgnvyewvadcwhdhyngapsdgsawmeekcelvqirgndwgeppifsrsgn
    rnnaapsdrgdwigfrvarel
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >5hhaB (B:)
    mgsshhhhhhsqdlevlfqgpgsdeakkpgtvfkdckdcpemvvlpagsftmgtpddevg
    rqpdegplhdvtfakpfaisryqvtageldaylkatgvkladgdtrpgreciagkpryqq
    gprqpavcvdyndvknyaawlskktgkryrmlseaereygaragsagpfpfpfdegkeys
    iakhantygasdgynftspvgsfppnafgvydmhgnvyewvadcwhdhyngapsdgsawm
    eekcelvqirgndwgeppifsrsgnrnnaapsdrgdwigfrvarel
    

    Sequence, based on observed residues (ATOM records):
    >5hhaB (B:)
    gsshhhhhhsqakkpgtvfkdckdcpemvvlpagsftmgtpddevgrqpdegplhdvtfa
    kpfaisryqvtageldaylkatgvkladgdtrpgreciagkpryqqgprqpavcvdyndv
    knyaawlskktgkryrmlseaereygaragsagpfpfpfdegkeysiakhantygasdgy
    nftspvgsfppnafgvydmhgnvyewvadcwhdhyngapsdgsawmeekcelvqirgndw
    geppifsrsgnrnnaapsdrgdwigfrvarel