PDB entry 5hh3

View 5hh3 on RCSB PDB site
Description: OxyA from Actinoplanes teichomyceticus
Class: oxidoreductase
Keywords: Cytochrome P450 monooxygenase, phenolic coupling enzyme, biosynthesis of glycopeptide antibiotics, peptide cyclase, oxidoreductase
Deposited on 2016-01-09, released 2016-02-10
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-09-06, with a file datestamp of 2017-09-01.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: N/A
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: OxyA protein
    Species: Actinoplanes teichomyceticus [TaxId:1867]
    Gene: tcp18
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5hh3a_
  • Chain 'C':
    Compound: OxyA protein
    Species: Actinoplanes teichomyceticus [TaxId:1867]
    Gene: tcp18
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q6ZZI8 (6-396)
      • expression tag (0-5)
    Domains in SCOPe 2.07: d5hh3c1, d5hh3c2
  • Heterogens: HEM, GOL, ACT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5hh3A (A:)
    gidpftmfeeinvvraaelhrrdrfdpvpqlrslmaegplttlgteespggrtawlatgy
    deirqvlssddfsarllyggtaagitwpgfltqydppehtrlrrmvapafavrrmqkfqp
    qvervvqdsldaiealggpvdfvprfgwsvattatcdflgiprddqadlarslhasrter
    sgkrrtaagnkfmtymnkmtartrrdpgddmfgvvvreygdeitdaeltgvaafvmgaga
    dqvarflaagawlmaddpeqfallrekpdtvpdwldevirylttdekthprvatddvrig
    dhlikagdtvtcsllaanrrnfprpedrfditrvrpehlafghgihhclgrslaelvfrt
    aipalahrfptlrlaephreirlgpppfdveallldw
    

    Sequence, based on observed residues (ATOM records): (download)
    >5hh3A (A:)
    eeinvvraaelhrrdrfdpvpqlrslmaegplttlgtgrtawlatgydeirqvlssddfs
    arlltaagitwpgfltqydppehtrlrrmvapafavrrmqkfqpqvervvqdsldaieal
    ggpvdfvprfgwsvattatcdflgiprddqadlarslhasrtersgkrrtaagnkfmtym
    nkmtartrrdpgddmfgvvvreygdeitdaeltgvaafvmgagadqvarflaagawlmad
    dpeqfallrekpdtvpdwldevirylttdekthprvatddvrigdhlikagdtvtcslla
    anrrnfprpedrfditrvrpehlafghgihhclgrslaelvfrtaipalahrfptlrlae
    phreirlgpppfdveallldw
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5hh3C (C:)
    gidpftmfeeinvvraaelhrrdrfdpvpqlrslmaegplttlgteespggrtawlatgy
    deirqvlssddfsarllyggtaagitwpgfltqydppehtrlrrmvapafavrrmqkfqp
    qvervvqdsldaiealggpvdfvprfgwsvattatcdflgiprddqadlarslhasrter
    sgkrrtaagnkfmtymnkmtartrrdpgddmfgvvvreygdeitdaeltgvaafvmgaga
    dqvarflaagawlmaddpeqfallrekpdtvpdwldevirylttdekthprvatddvrig
    dhlikagdtvtcsllaanrrnfprpedrfditrvrpehlafghgihhclgrslaelvfrt
    aipalahrfptlrlaephreirlgpppfdveallldw
    

    Sequence, based on observed residues (ATOM records): (download)
    >5hh3C (C:)
    gidpftmfeeinvvraaelhrrdrfdpvpqlrslmaegplttlgteespggrtawlatgy
    deirqvlssddfsarllyggtaagifltqydppehtrlrrmvapafavrrmqkfqpqver
    vvqdsldaiealggpvdfvprfgwsvattatcdflgiprddqadlarslhasrtersgkr
    rtaagnkfmtymnkmtartrrdpgddmfgvvvreygdeitdaeltgvaafvmgagadqva
    rflaagawlmaddpeqfallrekpdtvpdwldevirylttdekthprvatddvrigdhli
    kagdtvtcsllaanrrnfprpedrfditrvrpehlafghgihhclgrslaelvfrtaipa
    lahrfptlrlaephreirlgpppfdveallldw