PDB entry 5hgr

View 5hgr on RCSB PDB site
Description: Structure of Anabaena (Nostoc) sp. PCC 7120 Orange Carotenoid Protein binding canthaxanthin
Class: carotenoid binding protein
Keywords: carotenoid, photoprotection, cyanobacteria, CAROTENOID BINDING PROTEIN
Deposited on 2016-01-08, released 2016-11-16
The last revision prior to the SCOPe 2.07 freeze date was dated 2016-12-07, with a file datestamp of 2016-12-02.
Experiment type: XRAY
Resolution: 1.68 Å
R-factor: N/A
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Orange Carotenoid Protein (OCP)
    Species: Nostoc sp. (strain PCC 7120 / UTEX 2576) [TaxId:103690]
    Gene: all3149
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5hgra1, d5hgra2
  • Chain 'B':
    Compound: Orange Carotenoid Protein (OCP)
    Species: Nostoc sp. (strain PCC 7120 / UTEX 2576) [TaxId:103690]
    Gene: all3149
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5hgrb1, d5hgrb2
  • Heterogens: 45D, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5hgrA (A:)
    maitidsarrifpntlqadavpaltarfnqlsaedqlawtwfaflemgktitvaapgaas
    mqfaegilkqikemtfeeqtqvmcdlanhtdtpicrtyatwspniklgfwnqlgewmeqg
    avapipagyqlsananavletlksldqgqqitvlrssvvdmgfdaakldgytrvaeplva
    pkdisqrvqvtieginnstvlnymnnlnandfdeliklfvedgalqppfqrpivgkdail
    rffreecqnlnllpergvaepaddgytqvkvtgkvqtpwfgaavgmnmawrfllnpqgki
    ffvaidllaspkellnlvrhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5hgrA (A:)
    itidsarrifpntlqadavpaltarfnqlsaedqlawtwfaflemgktitvaapgaasmq
    faegilkqikemtfeeqtqvmcdlanhtdtpicrtyatwspniklgfwnqlgewmeqgav
    apipagyqlsananavletlksldqgqqitvlrssvvdmgfdaakldgytrvaeplvapk
    disqrvqvtieginnstvlnymnnlnandfdeliklfvedgalqppfqrpivgkdailrf
    freecqnlnllpergvaepaddgytqvkvtgkvqtpwfgaavgmnmawrfllnpqgkiff
    vaidllaspkellnl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5hgrB (B:)
    maitidsarrifpntlqadavpaltarfnqlsaedqlawtwfaflemgktitvaapgaas
    mqfaegilkqikemtfeeqtqvmcdlanhtdtpicrtyatwspniklgfwnqlgewmeqg
    avapipagyqlsananavletlksldqgqqitvlrssvvdmgfdaakldgytrvaeplva
    pkdisqrvqvtieginnstvlnymnnlnandfdeliklfvedgalqppfqrpivgkdail
    rffreecqnlnllpergvaepaddgytqvkvtgkvqtpwfgaavgmnmawrfllnpqgki
    ffvaidllaspkellnlvrhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5hgrB (B:)
    itidsarrifpntlqadavpaltarfnqlsaedqlawtwfaflemgktitvaapgaasmq
    faegilkqikemtfeeqtqvmcdlanhtdtpicrtyatwspniklgfwnqlgewmeqgav
    apipagyqlsananavletlksldqgqqitvlrssvvdmgfdaakvaeplvapkdisqrv
    qvtieginnstvlnymnnlnandfdeliklfvedgalqppfqrpivgkdailrffreecq
    nlnllpergvaepaddgytqvkvtgkvqtpwfgaavgmnmawrfllnpqgkiffvaidll
    aspkellnl