PDB entry 5hgo

View 5hgo on RCSB PDB site
Description: Hexameric HIV-1 CA R18G mutant
Class: viral protein
Keywords: Capsid, Viral Protein
Deposited on 2016-01-08, released 2016-08-10
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-09-13, with a file datestamp of 2017-09-08.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: capsid protein p24
    Species: HUMAN IMMUNODEFICIENCY VIRUS 1 [TaxId:11676]
    Gene: GAG
    Database cross-references and differences (RAF-indexed):
    • Uniprot P12493 (0-End)
      • engineered mutation (13)
      • engineered mutation (17)
      • engineered mutation (44)
    Domains in SCOPe 2.07: d5hgoa1, d5hgoa2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5hgoA (A:)
    pivqnlqgqmvhqcispgtlnawvkvveekafspevipmfsalscgatpqdlntmlntvg
    ghqaamqmlketineeaaewdrlhpvhagpiapgqmreprgsdiagttstlqeqigwmth
    nppipvgeiykrwiilglnkivrmysptsildirqgpkepfrdyvdrfyktlraeqasqe
    vknaatetllvqnanpdcktilkalgpgatleemmtacqgvggpghkarvl
    

    Sequence, based on observed residues (ATOM records): (download)
    >5hgoA (A:)
    pivqnlqgqmvhqcispgtlnawvkvveekafspevipmfsalscgatpqdlntmlntvg
    ghqaamqmlketineeaaewdrlhpvhiapgqmreprgsdiagttstlqeqigwmthnpp
    ipvgeiykrwiilglnkivrmysptsildirqgpkepfrdyvdrfyktlraeqtllvqna
    npdcktilkalgpgatleemmtacq