PDB entry 5hge

View 5hge on RCSB PDB site
Description: Filamentous Assembly of Green Fluorescent Protein Supported by a C-terminal fusion of 18-residues, viewed in space group P212121
Class: fluorescent protein
Keywords: filament, 2 sub 1 screw symmetry, FLUORESCENT PROTEIN
Deposited on 2016-01-08, released 2017-01-11
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-01, with a file datestamp of 2017-10-27.
Experiment type: XRAY
Resolution: 1.86 Å
R-factor: N/A
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Green fluorescent protein
    Species: Aequorea victoria [TaxId:6100]
    Gene: GFP
    Database cross-references and differences (RAF-indexed):
    • Uniprot P42212 (Start-235)
      • chromophore (64)
      • engineered mutation (65)
      • engineered mutation (69)
      • expression tag (236-245)
    Domains in SCOPe 2.07: d5hgea1, d5hgea2
  • Heterogens: MPD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5hgeA (A:)
    mskgeelftgvvpilveldgdvnghkfsvsgegegdatygkltlkficttgklpvpwptl
    vttfxlqcfarypdhmkqhdffksampegyvqertiffkddgnyktraevkfegdtlvnr
    ielkgidfkedgnilghkleynynshnvyimadkqkngikvnfkirhniedgsvqladhy
    qqntpigdgpvllpdnhylstqsalskdpnekrdhmvllefvtaagithgmdelykamak
    etaaakfdhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5hgeA (A:)
    geelftgvvpilveldgdvnghkfsvsgegegdatygkltlkficttgklpvpwptlvtt
    fxlqcfarypdhmkqhdffksampegyvqertiffkddgnyktraevkfegdtlvnriel
    kgidfkedgnilghkleynynshnvyimadkqkngikvnfkirhniedgsvqladhyqqn
    tpigdgpvllpdnhylstqsalskdpnekrdhmvllefvtaagithgmdelykamaketa
    aak