PDB entry 5hg8

View 5hg8 on RCSB PDB site
Description: EGFR (L858R, T790M, V948R) in complex with N-[3-({2-[(1-methyl-1H-pyrazol-4-yl)amino]-7H-pyrrolo[2,3-d]pyrimidin-4-yl}oxy)phenyl]prop-2-enamide
Class: transferase/transferase inhibitor
Keywords: EGFR, Kinase, Inhibitor, Lung Cancer, TRANSFERASE-TRANSFERASE INHIBITOR complex
Deposited on 2016-01-08, released 2016-02-03
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-22, with a file datestamp of 2017-11-17.
Experiment type: XRAY
Resolution: 1.42 Å
R-factor: N/A
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Epidermal growth factor receptor
    Species: Homo sapiens [TaxId:9606]
    Gene: EGFR, ERBB, ERBB1, HER1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00533
      • engineered mutation (96)
      • engineered mutation (164)
      • engineered mutation (254)
    Domains in SCOPe 2.07: d5hg8a_
  • Heterogens: 634, SO4, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5hg8A (A:)
    gsgeapnqallrilketefkkikvlgsgafgtvykglwipegekvkipvaikelreatsp
    kankeildeayvmasvdnphvcrllgicltstvqlimqlmpfgclldyvrehkdnigsqy
    llnwcvqiakgmnyledrrlvhrdlaarnvlvktpqhvkitdfgrakllgaeekeyhaeg
    gkvpikwmalesilhriythqsdvwsygvtvwelmtfgskpydgipaseissilekgerl
    pqppictidvymimrkcwmidadsrpkfreliiefskmardpqrylviqgdermhlpspt
    dsnfyralmdeedmddvvdadeylipqqg
    

    Sequence, based on observed residues (ATOM records): (download)
    >5hg8A (A:)
    nqallrilketefkkikvlgsgafgtvykglwipegekvkipvaikelreatspkankei
    ldeayvmasvdnphvcrllgicltstvqlimqlmpfgclldyvrehkdnigsqyllnwcv
    qiakgmnyledrrlvhrdlaarnvlvktpqhvkitdfgrakllgaeekeyhaeggkvpik
    wmalesilhriythqsdvwsygvtvwelmtfgskpydgipaseissilekgerlpqppic
    tidvymimrkcwmidadsrpkfreliiefskmardpqrylviqgdermhlpsptdsnfyr