PDB entry 5hg2

View 5hg2 on RCSB PDB site
Description: backbone modifications in the protein gb1 helix: beta-3-ala24, beta-3- lys28, beta-3-lys31, beta-2-asn35
Deposited on 2016-01-07, released 2016-02-24
The last revision was dated 2019-12-25, with a file datestamp of 2019-12-20.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: N/A
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Immunoglobulin G-binding protein G
    Species: Streptococcus sp. group G, synthetic [TaxId:1320]
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: Immunoglobulin G-binding protein G
    Species: Streptococcus sp. group G, synthetic [TaxId:1320]
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: Immunoglobulin G-binding protein G
    Species: Streptococcus sp. group G, synthetic [TaxId:1320]
    Database cross-references and differences (RAF-indexed):
  • Chain 'D':
    Compound: Immunoglobulin G-binding protein G
    Species: Streptococcus sp. group G, synthetic [TaxId:1320]
    Database cross-references and differences (RAF-indexed):
  • Heterogens: GOL, MG, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >5hg2A (A:)
    dtyklilngktlkgettteavdaataekvfkqyaxdngvdgewtyddatktftvte
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records:
    >5hg2B (B:)
    dtyklilngktlkgettteavdaataekvfkqyaxdngvdgewtyddatktftvte
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records:
    >5hg2C (C:)
    dtyklilngktlkgettteavdaataekvfkqyaxdngvdgewtyddatktftvte
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records:
    >5hg2D (D:)
    dtyklilngktlkgettteavdaataekvfkqyaxdngvdgewtyddatktftvte