PDB entry 5hft

View 5hft on RCSB PDB site
Description: crystal structure of hpxw
Deposited on 2016-01-07, released 2016-06-29
The last revision was dated 2019-12-25, with a file datestamp of 2019-12-20.
Experiment type: XRAY
Resolution: 2.65 Å
R-factor: N/A
AEROSPACI score: 0.18 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Gamma-glutamyltranspeptidase
    Species: Klebsiella pneumoniae subsp. pneumoniae [TaxId:272620]
    Gene: KPN_01768
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: Gamma-glutamyltranspeptidase
    Species: Klebsiella pneumoniae subsp. pneumoniae [TaxId:272620]
    Gene: KPN_01768
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: Gamma-glutamyltranspeptidase
    Species: Klebsiella pneumoniae subsp. pneumoniae [TaxId:272620]
    Gene: KPN_01768
    Database cross-references and differences (RAF-indexed):
  • Chain 'D':
    Compound: Gamma-glutamyltranspeptidase
    Species: Klebsiella pneumoniae subsp. pneumoniae [TaxId:272620]
    Gene: KPN_01768
    Database cross-references and differences (RAF-indexed):

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >5hftA (A:)
    mgsdkihhhhhhssgenlyfqghmhssnvsthgmavaphhlasqsalailreggsaieam
    vaaaaaiavvyphmnglggdgfwlivppegdpiaidasgaagslatleayagqrhipnrg
    pqaaltvagtvsgwvealrisrdltgralpvarlladaigyaedgipvtasqahataskl
    eelrhqpgfsetwlvageaprpgsrfrqpalagtlrmlasdgldsfyrgplaerlaqgma
    algmpitlgdlqahrarrpgpltlqhqqgtlwnlapptqglvslailgitdrlkmadadd
    aqtvhriveatkrafalrdahitdprhldvdvqqlltpealqpladsiddasaspwgggk
    gpgd
    

    Sequence, based on observed residues (ATOM records):
    >5hftA (A:)
    ssnvsthgmavaphhlasqsalailreggsaieamvaaaaaiavvyphmnglggdgfwli
    vppegdpiaidasgaagslatleayagqrhipnrgpqaaltvagtvsgwvealrisrdlt
    gralpvarlladaigyaedgipvtasqahataskleelrhqpgfsetwlvageaprpgsr
    frqpalagtlrmlasdgldsfyrgplaerlaqgmaalgmpitlgdlqahrarrpgpltlq
    hqqgtlwnlapptqglvslailgtdkmadaqtvhrveatkrafalrdtdprqqlltpeal
    qpads
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >5hftB (B:)
    tvwmgvvdnsglavsfiqsiyhefgsgvvlpdtgivwqnrgaafsldpqhllalapgkqp
    fhtlnpaaarlndgrvmvygsmggdgqpqtqaalftryilqgvplqesisrprwllgrtw
    gqssdslklegrfapaciarlrelghdvevladfseamghagaivrhpngllegatdprs
    ngaaagy
    

    Sequence, based on observed residues (ATOM records):
    >5hftB (B:)
    tvwmgvvdnsglavsfiqsiyhefgsgvvlpdtgivwqnrgaafsldpgkqpfhlnpaaa
    rlndgrvmvygsmggqpqtqaalftryilqgvplqesisrprwlklegrfevladfseam
    ghagaivrhpngllegatdprsngaaagy
    

  • Chain 'C':
    Sequence, based on SEQRES records:
    >5hftC (C:)
    mgsdkihhhhhhssgenlyfqghmhssnvsthgmavaphhlasqsalailreggsaieam
    vaaaaaiavvyphmnglggdgfwlivppegdpiaidasgaagslatleayagqrhipnrg
    pqaaltvagtvsgwvealrisrdltgralpvarlladaigyaedgipvtasqahataskl
    eelrhqpgfsetwlvageaprpgsrfrqpalagtlrmlasdgldsfyrgplaerlaqgma
    algmpitlgdlqahrarrpgpltlqhqqgtlwnlapptqglvslailgitdrlkmadadd
    aqtvhriveatkrafalrdahitdprhldvdvqqlltpealqpladsiddasaspwgggk
    gpgd
    

    Sequence, based on observed residues (ATOM records):
    >5hftC (C:)
    snvsthgmavaphhlasqsalailreggsaieamvaaaaaiavvyphmnglggdgfwliv
    ppegdpiaidasgaagslatleayagqrhipnrgpqaaltvagtvsgwvealrisrdltg
    ralpvarlladaigyaedgipvtasqahataskleelrhqpgfsetwlvageaprpgsrf
    rqpalagtlrmlasdgldsfyrgplaerlaqgmaalgmpitlgdlqahrarrpgpltlqh
    qqgtlwnlapptqglvslatdkmadaddaqtvhriveatkrafrdahqqltpealqds
    

  • Chain 'D':
    Sequence, based on SEQRES records:
    >5hftD (D:)
    tvwmgvvdnsglavsfiqsiyhefgsgvvlpdtgivwqnrgaafsldpqhllalapgkqp
    fhtlnpaaarlndgrvmvygsmggdgqpqtqaalftryilqgvplqesisrprwllgrtw
    gqssdslklegrfapaciarlrelghdvevladfseamghagaivrhpngllegatdprs
    ngaaagy
    

    Sequence, based on observed residues (ATOM records):
    >5hftD (D:)
    tvwmgvvdnsglavsfiqsiyhefgsgvvlpdtgivwqnrgaafsldpqhllalapgkqp
    fhtlnpaaarlndgrvmvygsmggpqtqaalftryilqgvplqesisrprwklegrvlad
    fseamghagaivrhpngllegatdprsngaaagy