PDB entry 5hfn

View 5hfn on RCSB PDB site
Description: Crystal structure of a loop truncation variant of Thermotoga maritima Acetyl Esterase TM0077 (apo structure) at 2.75 Angstrom resolution
Class: hydrolase
Keywords: hydrolase, carbohydrate metabolism, cephalosporin C deacetylase, Rossmann fold
Deposited on 2016-01-07, released 2016-05-25
The last revision prior to the SCOPe 2.08 freeze date was dated 2016-05-25, with a file datestamp of 2016-05-20.
Experiment type: XRAY
Resolution: 2.75 Å
R-factor: N/A
AEROSPACI score: 0.18 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cephalosporin-C deacetylase
    Species: Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) [TaxId:243274]
    Gene: axeA, TM_0077
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d5hfna_
  • Chain 'B':
    Compound: Cephalosporin-C deacetylase
    Species: Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) [TaxId:243274]
    Gene: axeA, TM_0077
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d5hfnb_
  • Chain 'C':
    Compound: Cephalosporin-C deacetylase
    Species: Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) [TaxId:243274]
    Gene: axeA, TM_0077
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d5hfnc_
  • Chain 'D':
    Compound: Cephalosporin-C deacetylase
    Species: Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) [TaxId:243274]
    Gene: axeA, TM_0077
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9WXT2 (12-End)
      • expression tag (9-11)
    Domains in SCOPe 2.08: d5hfnd1, d5hfnd2
  • Chain 'E':
    Compound: Cephalosporin-C deacetylase
    Species: Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) [TaxId:243274]
    Gene: axeA, TM_0077
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d5hfne_
  • Chain 'F':
    Compound: Cephalosporin-C deacetylase
    Species: Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) [TaxId:243274]
    Gene: axeA, TM_0077
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d5hfnf_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5hfnA (A:)
    mgsdkihhhhhhmaffdlpleelkkyrperyeekdfdefweetlaesekfpldpvferme
    shlktveaydvtfsgyrgqrikgwllvpkleeeklpcvvqyigynggrgfphdwlfwpsm
    gyicfvmdtrgtrgildprtyyyrrvftdavraveaaasfpqvdqeriviaggsqgggia
    lavsalskkakallcdvpflchfrravqlvdthpyaeitnflkthrdkeeivfrtlsyfd
    gvnfaarakipalfsvglmdnicppstvfaaynyyagpkeiriypynnhegggsfqaveq
    vkflkklfekg
    

    Sequence, based on observed residues (ATOM records): (download)
    >5hfnA (A:)
    affdlpleelkkyrperyeekdfdefweetlaesekfpldpvfermeshlktveaydvtf
    sgyrgqrikgwllvpkleeeklpcvvqyigrgfphdwlfwpsmgyicfvmdtyyrrvftd
    avraveaaasfpqvdqeriviaggsqgggialavsalskkakallcdvpflchfrravql
    vdthpyaeitnflkthrdkeeivfrtlsyfdgvnfaarakipalfsvglmdnicppstvf
    aaynyyagpkeiriypynnhegggsfqaveqvkflkklfe
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5hfnB (B:)
    mgsdkihhhhhhmaffdlpleelkkyrperyeekdfdefweetlaesekfpldpvferme
    shlktveaydvtfsgyrgqrikgwllvpkleeeklpcvvqyigynggrgfphdwlfwpsm
    gyicfvmdtrgtrgildprtyyyrrvftdavraveaaasfpqvdqeriviaggsqgggia
    lavsalskkakallcdvpflchfrravqlvdthpyaeitnflkthrdkeeivfrtlsyfd
    gvnfaarakipalfsvglmdnicppstvfaaynyyagpkeiriypynnhegggsfqaveq
    vkflkklfekg
    

    Sequence, based on observed residues (ATOM records): (download)
    >5hfnB (B:)
    fdlpleelkkyrperyeekdfdefweetlaesekfpldpvfermeshlktveaydvtfsg
    yrgqrikgwllvpkleeeklpcvvqyirgfphdwlfwpsmgyicfvmdtryyrrvftdav
    raveaaasfpqvdqeriviaggsqgggialavsalskkakallcdvpflchfrravqlvd
    thpyaeitnflkthrdkeeivfrtlsyfdgvnfaarakipalfsvglmdnicppstvfaa
    ynyyagpkeiriypynnhegggsfqaveqvkflkklfe
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5hfnC (C:)
    mgsdkihhhhhhmaffdlpleelkkyrperyeekdfdefweetlaesekfpldpvferme
    shlktveaydvtfsgyrgqrikgwllvpkleeeklpcvvqyigynggrgfphdwlfwpsm
    gyicfvmdtrgtrgildprtyyyrrvftdavraveaaasfpqvdqeriviaggsqgggia
    lavsalskkakallcdvpflchfrravqlvdthpyaeitnflkthrdkeeivfrtlsyfd
    gvnfaarakipalfsvglmdnicppstvfaaynyyagpkeiriypynnhegggsfqaveq
    vkflkklfekg
    

    Sequence, based on observed residues (ATOM records): (download)
    >5hfnC (C:)
    ffdlpleelkkyrperyeekdfdefweetlaesekfpldpvfermeshlktveaydvtfs
    gyrgqrikgwllvpkleeeklpcvvqyirgfphdwlfwpsmgyicfvmdtryyrrvftda
    vraveaaasfpqvdqeriviaggsqgggialavsalskkakallcdvpflchfrravqlv
    dthpyaeitnflkthrdkeeivfrtlsyfdgvnfaarakipalfsvglmdnicppstvfa
    aynyyagpkeiriypynnhegggsfqaveqvkflkklfe
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5hfnD (D:)
    mgsdkihhhhhhmaffdlpleelkkyrperyeekdfdefweetlaesekfpldpvferme
    shlktveaydvtfsgyrgqrikgwllvpkleeeklpcvvqyigynggrgfphdwlfwpsm
    gyicfvmdtrgtrgildprtyyyrrvftdavraveaaasfpqvdqeriviaggsqgggia
    lavsalskkakallcdvpflchfrravqlvdthpyaeitnflkthrdkeeivfrtlsyfd
    gvnfaarakipalfsvglmdnicppstvfaaynyyagpkeiriypynnhegggsfqaveq
    vkflkklfekg
    

    Sequence, based on observed residues (ATOM records): (download)
    >5hfnD (D:)
    hhhmaffdlpleelkkyrperyeekdfdefweetlaesekfpldpvfermeshlktveay
    dvtfsgyrgqrikgwllvpkleeeklpcvvqyirgfphdwlfwpsmgyicfvmdtyyrrv
    ftdavraveaaasfpqvdqeriviaggsqgggialavsalskkakallcdvpflchfrra
    vqlvdthpyaeitnflkthrdkeeivfrtlsyfdgvnfaarakipalfsvglmdnicpps
    tvfaaynyyagpkeiriypynnhegggsfqaveqvkflkklfe
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >5hfnE (E:)
    mgsdkihhhhhhmaffdlpleelkkyrperyeekdfdefweetlaesekfpldpvferme
    shlktveaydvtfsgyrgqrikgwllvpkleeeklpcvvqyigynggrgfphdwlfwpsm
    gyicfvmdtrgtrgildprtyyyrrvftdavraveaaasfpqvdqeriviaggsqgggia
    lavsalskkakallcdvpflchfrravqlvdthpyaeitnflkthrdkeeivfrtlsyfd
    gvnfaarakipalfsvglmdnicppstvfaaynyyagpkeiriypynnhegggsfqaveq
    vkflkklfekg
    

    Sequence, based on observed residues (ATOM records): (download)
    >5hfnE (E:)
    affdlpleelkkyrperyeekdfdefweetlaesekfpldpvfermeshlktveaydvtf
    sgyrgqrikgwllvpkleeeklpcvvqyirgfphdwlfwpsmgyicfvmdtyyrrvftda
    vraveaaasfpqvdqeriviaggsqgggialavsalskkakallcdvpflchfrravqlv
    dthpyaeitnflkthrdkeeivfrtlsyfdgvnfaarakipalfsvglmdnicppstvfa
    aynyyagpkeiriypynnhegggsfqaveqvkflkklfe
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >5hfnF (F:)
    mgsdkihhhhhhmaffdlpleelkkyrperyeekdfdefweetlaesekfpldpvferme
    shlktveaydvtfsgyrgqrikgwllvpkleeeklpcvvqyigynggrgfphdwlfwpsm
    gyicfvmdtrgtrgildprtyyyrrvftdavraveaaasfpqvdqeriviaggsqgggia
    lavsalskkakallcdvpflchfrravqlvdthpyaeitnflkthrdkeeivfrtlsyfd
    gvnfaarakipalfsvglmdnicppstvfaaynyyagpkeiriypynnhegggsfqaveq
    vkflkklfekg
    

    Sequence, based on observed residues (ATOM records): (download)
    >5hfnF (F:)
    fdlpleelkkyrperyeekdfdefweetlaesekfpldpvfermeshlktveaydvtfsg
    yrgqrikgwllvpkleeeklpcvvqyigrgfphdwlfwpsmgyicfvmdtryyrrvftda
    vraveaaasfpqvdqeriviaggsqgggialavsalskkakallcdvpflchfrravqlv
    dthpyaeitnflkthrdkeeivfrtlsyfdgvnfaarakipalfsvglmdnicppstvfa
    aynyyagpkeiriypynnhegggsfqaveqvkflkklfe