PDB entry 5hf7

View 5hf7 on RCSB PDB site
Description: tdg enzyme-substrate complex
Deposited on 2016-01-06, released 2016-09-28
The last revision was dated 2019-12-25, with a file datestamp of 2019-12-20.
Experiment type: XRAY
Resolution: 1.54 Å
R-factor: N/A
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: G/T mismatch-specific thymine DNA glycosylase
    Species: Homo sapiens [TaxId:9606]
    Gene: TDG
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: DNA (28-mer)
    Species: UNIDENTIFIED, synthetic [TaxId:32644]
  • Chain 'D':
    Compound: DNA (28-mer)
    Species: UNIDENTIFIED, synthetic [TaxId:32644]
  • Heterogens: HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >5hf7A (A:)
    skksgksakskekqekitdtfkvkrkvdrfngvseaelltktlpdiltfnldiviiginp
    glmaaykghhypgpgnhfwkclfmsglsevqlnhmddhtlpgkygigftnmverttpgsk
    dlsskefreggrilvqklqkyqpriavfngkciyeifskevfgvkvknlefglqphkipd
    tetlcyvmpsssarcaqfpraqdkvhyyiklkdlrdqlkgiernmdv
    

    Sequence, based on observed residues (ATOM records):
    >5hf7A (A:)
    kvdrfngvseaelltktlpdiltfnldiviiginpglmaaykghhypgpgnhfwkclfms
    glsevqlnhmddhtlpgkygigftnmverttpgskdlsskefreggrilvqklqkyqpri
    avfngkciyeifskevfgvkvknlefglqphkipdtetlcyvmpsssarcaqfpraqdkv
    hyyiklkdlrdqlkgie
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.