PDB entry 5hf4

View 5hf4 on RCSB PDB site
Description: The third PDZ domain from the synaptic protein PSD-95 (H372A mutant)
Class: peptide binding protein
Keywords: PDZ, GLGF, DHR, adhesion, synapse, synaptic density, peptide-binding domain, PEPTIDE BINDING PROTEIN
Deposited on 2016-01-06, released 2017-01-11
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-01-11, with a file datestamp of 2017-01-06.
Experiment type: XRAY
Resolution: 1.75 Å
R-factor: N/A
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Disks large homolog 4
    Species: Rattus norvegicus [TaxId:10116]
    Gene: DLG4, DLGH4, PSD95
    Database cross-references and differences (RAF-indexed):
    • Uniprot P31016 (5-105)
      • expression tag (1-4)
      • engineered mutation (75)
      • expression tag (106-118)
    Domains in SCOPe 2.07: d5hf4a1, d5hf4a2, d5hf4a3
  • Heterogens: GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >5hf4A (A:)
gspeflgeedipreprrivihrgstglgfnivggedgegifisfilaggpadlsgelrkg
dqilsvngvdlrnasaeqaaialknagqtvtiiaqykpeeysrfeansrvdssgrivtd

    Sequence, based on observed residues (ATOM records): (download) 
    >5hf4A (A:)
speflgeedipreprrivihrgstglgfnivggedgegifisfilaggpadlsgelrkgd
qilsvngvdlrnasaeqaaialknagqtvtiiaqykpeeysrfeansrvdssgrivtd