PDB entry 5hez

View 5hez on RCSB PDB site
Description: JAK2 kinase (JH1 domain) mutant P1057A in complex with TG101209
Class: transferase/transferase inhibitor
Keywords: protein kinase, inhibitor, mutation, TYK2, surrogate, P1104A, TRANSFERASE-TRANSFERASE INHIBITOR complex
Deposited on 2016-01-06, released 2016-11-09
The last revision prior to the SCOPe 2.08 freeze date was dated 2016-11-16, with a file datestamp of 2016-11-11.
Experiment type: XRAY
Resolution: 2.66 Å
R-factor: N/A
AEROSPACI score: 0.18 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Tyrosine-protein kinase JAK2
    Species: Homo sapiens [TaxId:9606]
    Gene: JAK2
    Database cross-references and differences (RAF-indexed):
    • Uniprot O60674 (Start-301)
      • engineered mutation (226)
    Domains in SCOPe 2.08: d5heza_
  • Chain 'B':
    Compound: Tyrosine-protein kinase JAK2
    Species: Homo sapiens [TaxId:9606]
    Gene: JAK2
    Database cross-references and differences (RAF-indexed):
    • Uniprot O60674 (Start-301)
      • engineered mutation (226)
    Domains in SCOPe 2.08: d5hezb_
  • Chain 'C':
    Compound: Tyrosine-protein kinase JAK2
    Species: Homo sapiens [TaxId:9606]
    Gene: JAK2
    Database cross-references and differences (RAF-indexed):
    • Uniprot O60674 (Start-301)
      • engineered mutation (226)
    Domains in SCOPe 2.08: d5hezc_
  • Chain 'D':
    Compound: Tyrosine-protein kinase JAK2
    Species: Homo sapiens [TaxId:9606]
    Gene: JAK2
    Database cross-references and differences (RAF-indexed):
    • Uniprot O60674 (Start-301)
      • engineered mutation (226)
    Domains in SCOPe 2.08: d5hezd_
  • Heterogens: CL, ZN, 1M3, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5hezA (A:)
    gssgafedrdptqfeerhlkflqqlgkgnfgsvemcrydplqdntgevvavkklqhstee
    hlrdfereieilkslqhdnivkykgvcysagrrnlklimeylpygslrdylqkhkeridh
    ikllqytsqickgmeylgtkryihrdlatrnilvenenrvkigdfgltkvlpqdkeyykv
    kepgespifwyapeslteskfsvasdvwsfgvvlyelftyieksksapaefmrmigndkq
    gqmivfhliellknngrlprpdgcpdeiymimtecwnnnvnqrpsfrdlalrvdqirdnm
    ag
    

    Sequence, based on observed residues (ATOM records): (download)
    >5hezA (A:)
    tqfeerhlkflqqlgkgnfgsvemcrydplqdntgevvavkklqhsteehlrdfereiei
    lkslqhdnivkykgvcysarnlklimeylpygslrdylqkhkeridhikllqytsqickg
    meylgtkryihrdlatrnilvenenrvkigdfgltkvlpqdkeyykvkepgespifwyap
    eslteskfsvasdvwsfgvvlyelftyieksksapaefmrmigndkqgqmivfhliellk
    nngrlprpdgcpdeiymimtecwnnnvnqrpsfrdlalrvdqirdnmag
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5hezB (B:)
    gssgafedrdptqfeerhlkflqqlgkgnfgsvemcrydplqdntgevvavkklqhstee
    hlrdfereieilkslqhdnivkykgvcysagrrnlklimeylpygslrdylqkhkeridh
    ikllqytsqickgmeylgtkryihrdlatrnilvenenrvkigdfgltkvlpqdkeyykv
    kepgespifwyapeslteskfsvasdvwsfgvvlyelftyieksksapaefmrmigndkq
    gqmivfhliellknngrlprpdgcpdeiymimtecwnnnvnqrpsfrdlalrvdqirdnm
    ag
    

    Sequence, based on observed residues (ATOM records): (download)
    >5hezB (B:)
    tqfeerhlkflqqlgkgnfgsvemcrydplqdntgevvavkklqhsteehlrdfereiei
    lkslqhdnivkykgvcysagrrnlklimeylpygslrdylqkhkeridhikllqytsqic
    kgmeylgtkryihrdlatrnilvenenrvkigdfgltkvlpqdkeyykvkepgespifwy
    apeslteskfsvasdvwsfgvvlyelftyieksksapaefmrmigndkqgqmivfhliel
    lknngrlprpdgcpdeiymimtecwnnnvnqrpsfrdlalrvdqirdnmag
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5hezC (C:)
    gssgafedrdptqfeerhlkflqqlgkgnfgsvemcrydplqdntgevvavkklqhstee
    hlrdfereieilkslqhdnivkykgvcysagrrnlklimeylpygslrdylqkhkeridh
    ikllqytsqickgmeylgtkryihrdlatrnilvenenrvkigdfgltkvlpqdkeyykv
    kepgespifwyapeslteskfsvasdvwsfgvvlyelftyieksksapaefmrmigndkq
    gqmivfhliellknngrlprpdgcpdeiymimtecwnnnvnqrpsfrdlalrvdqirdnm
    ag
    

    Sequence, based on observed residues (ATOM records): (download)
    >5hezC (C:)
    tqfeerhlkflqqlgkgnfgsvemcrydplqdntgevvavkklqhsteehlrdfereiei
    lkslqhdnivkykgvcysagrrnlklimeylpygslrdylqkhkeridhikllqytsqic
    kgmeylgtkryihrdlatrnilvenenrvkigdfgltkvlpqdkeyykvkepgespifwy
    apeslteskfsvasdvwsfgvvlyelftyieksksapaefmrmigndkqgqmivfhliel
    lknngrlprpdgcpdeiymimtecwnnnvnqrpsfrdlalrvdqirdnmag
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5hezD (D:)
    gssgafedrdptqfeerhlkflqqlgkgnfgsvemcrydplqdntgevvavkklqhstee
    hlrdfereieilkslqhdnivkykgvcysagrrnlklimeylpygslrdylqkhkeridh
    ikllqytsqickgmeylgtkryihrdlatrnilvenenrvkigdfgltkvlpqdkeyykv
    kepgespifwyapeslteskfsvasdvwsfgvvlyelftyieksksapaefmrmigndkq
    gqmivfhliellknngrlprpdgcpdeiymimtecwnnnvnqrpsfrdlalrvdqirdnm
    ag
    

    Sequence, based on observed residues (ATOM records): (download)
    >5hezD (D:)
    tqfeerhlkflqqlgkgnfgsvemcrydplqdntgevvavkklqhsteehlrdfereiei
    lkslqhdnivkykgvcysagrrnlklimeylpygslrdylqkhkeridhikllqytsqic
    kgmeylgtkryihrdlatrnilvenenrvkigdfgltkvlpqdkeyykvkepgespifwy
    apeslteskfsvasdvwsfgvvlyelftyieksksapaefmrmigndkqgqmivfhliel
    lknngrlprpdgcpdeiymimtecwnnnvnqrpsfrdlalrvdqirdnmag