PDB entry 5hex

View 5hex on RCSB PDB site
Description: Crystal Structure of Human Hexokinase 2 with cmpd 30, a 2-amino-6-benzenesulfonamide glucosamine
Class: transferase/transferase inhibitor
Keywords: inhibitor complex, TRANSFERASE-TRANSFERASE INHIBITOR complex
Deposited on 2016-01-06, released 2016-03-30
The last revision prior to the SCOPe 2.07 freeze date was dated 2016-03-30, with a file datestamp of 2016-03-25.
Experiment type: XRAY
Resolution: 2.73 Å
R-factor: N/A
AEROSPACI score: 0.17 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5hexA (A:)
    mgsshhhhhhssglenlyfqgsdqvqkvdqylyhmrlsdetlleiskrfrkemekglgat
    thptaavkmlptfvrstpdgtehgeflaldlggtnfrvlwvkvtdnglqkvemenqiyai
    pedimrgsgtqlfdhiaeclanfmdklqikdkklplgftfsfpchqtkldesflvswtkg
    fkssgvegrdvvalirkaiqrrgdfdidivavvndtvgtmmtcgyddhnceiglivgtgs
    nacymeemrhidmvegdegrmcinmewgafgddgslndirtefdqeidmgslnpgkqlfe
    kmisgmymgelvrlilvkmakeellfggklspellntgrfetkdisdiegekdgirkare
    vlmrlgldptqedcvathricqivstrsaslcaatlaavlqrikenkgeerlrstigvdg
    svykkhphfakrlhktvrrlvpgcdvrflrsedgsgkgaamvtavayrladqhrarqktl
    ehlqlshdqllevkrrmkvemerglskethasapvkmlptyvcatpdgtekgdflaldlg
    gtnfrvllvrvrngkwggvemhnkiyaipqevmhgtgdelfdhivqciadfleymgmkgv
    slplgftfsfpcqqnsldesillkwtkgfkasgcegedvvtllkeaihrreefdldvvav
    vndtvgtmmtcgfedphcevglivgtgsnacymeemrnvelvegeegrmcvnmewgafgd
    ngclddfrtefdvavdelslnpgkqrfekmisgmylgeivrnilidftkrgllfrgrise
    rlktrgifetkflsqiesdclallqvrailqhlglestcddsiivkevctvvarraaqlc
    gagmaavvdrirenrgldalkvtvgvdgtlyklhphfakvmhetvkdlapkcdvsflqse
    dgsgkgaalitavacrireagqr
    

    Sequence, based on observed residues (ATOM records): (download)
    >5hexA (A:)
    dqvqkvdqylyhmrlsdetlleiskrfrkemekglgatthptaavkmlptfvrstpdgte
    hgeflaldlggtnfrvlwvkvtdnglqkvemenqiyaipedisgtqlfdhiaeclanfmd
    klqikdkklplgftfsfpchqtkldesflvgrdvvalirkaiqrrgdfdidivavvndtv
    gtmmtcgyddhnceiglivgtgsnacymeemrhidmvegdegrmcinmewgafgddgsln
    dirtefdqeidmgslnpgkqlfekmisgmymgelvrlilvkmakeellfggklspellnt
    grfetkdisdiegekdgirkarevlmrlgldptqedcvathricqivstrsaslcaatla
    avlqrikenkgeerlrstigvdgsvykkhphfakrlhktvrrlvpgcdvrflrsedgsgk
    gaamvtavayrladqhrarqktlehlqlshdqllevkrrmkvemerglskethasapvkm
    lptyvcatpdgtekgdflaldlggtnfrvllvrvrngkwggvemhnkiyaipqevmhgtg
    delfdhivqciadfleymgmkgvslplgftfsfpcqqnsldesillkwtkgfkasgcege
    dvvtllkeaihrreefdldvvavvndtvgtmmtcgfedphcevglivgtgsnacymeemr
    nvelvegeegrmcvnmewgafgdngclddfrtefdvavdelslnpgkqrfekmisgmylg
    eivrnilidftkrgllfrgriserlktrgifetkflsqiesdclallqvrailqhlgles
    tcddsiivkevctvvarraaqlcgagmaavvdrirenrgldalkvtvgvdgtlyklhphf
    akvmhetvkdlapkcdvsflqsedgsgkgaalitavacri
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5hexB (B:)
    mgsshhhhhhssglenlyfqgsdqvqkvdqylyhmrlsdetlleiskrfrkemekglgat
    thptaavkmlptfvrstpdgtehgeflaldlggtnfrvlwvkvtdnglqkvemenqiyai
    pedimrgsgtqlfdhiaeclanfmdklqikdkklplgftfsfpchqtkldesflvswtkg
    fkssgvegrdvvalirkaiqrrgdfdidivavvndtvgtmmtcgyddhnceiglivgtgs
    nacymeemrhidmvegdegrmcinmewgafgddgslndirtefdqeidmgslnpgkqlfe
    kmisgmymgelvrlilvkmakeellfggklspellntgrfetkdisdiegekdgirkare
    vlmrlgldptqedcvathricqivstrsaslcaatlaavlqrikenkgeerlrstigvdg
    svykkhphfakrlhktvrrlvpgcdvrflrsedgsgkgaamvtavayrladqhrarqktl
    ehlqlshdqllevkrrmkvemerglskethasapvkmlptyvcatpdgtekgdflaldlg
    gtnfrvllvrvrngkwggvemhnkiyaipqevmhgtgdelfdhivqciadfleymgmkgv
    slplgftfsfpcqqnsldesillkwtkgfkasgcegedvvtllkeaihrreefdldvvav
    vndtvgtmmtcgfedphcevglivgtgsnacymeemrnvelvegeegrmcvnmewgafgd
    ngclddfrtefdvavdelslnpgkqrfekmisgmylgeivrnilidftkrgllfrgrise
    rlktrgifetkflsqiesdclallqvrailqhlglestcddsiivkevctvvarraaqlc
    gagmaavvdrirenrgldalkvtvgvdgtlyklhphfakvmhetvkdlapkcdvsflqse
    dgsgkgaalitavacrireagqr
    

    Sequence, based on observed residues (ATOM records): (download)
    >5hexB (B:)
    dqvqkvdqylyhmrlsdetlleiskrfrkemekglgatthptaavkmlptfvrstpdgte
    hgeflaldlggtnfrvlwvkvtdnglqkvemenqiyaipedimrgsgtqlfdhiaeclan
    fmdklqikdkklplgftfsfpchqtkldesflvsssgvegrdvvalirkaiqrrgdfdid
    ivavvndtvgtmmtcgyddhnceiglivgtgsnacymeemrhidmvegdegrmcinmewg
    afgddgslndirtefdqeidmgslnpgkqlfekmisgmymgelvrlilvkmakeellfgg
    klspellntgrfetkdisdiegekdgirkarevlmrlgldptqedcvathricqivstrs
    aslcaatlaavlqrikenkgeerlrstigvdgsvykkhphfakrlhktvrrlvpgcdvrf
    lrsedgsgkgaamvtavayrladqhrarqktlehlqlshdqllevkrrmkvemerglske
    thasapvkmlptyvcatpdgtekgdflaldlggtnfrvllvrvrngkwggvemhnkiyai
    pqevmhgtgdelfdhivqciadfleymgmkgvslplgftfsfpcqqnsldesillkwtkg
    fkasgcegedvvtllkeaihrreefdldvvavvndtvgtmmtcgfedphcevglivgtgs
    nacymeemrnvelvegeegrmcvnmewgafgdngclddfrtefdvavdelslnpgkqrfe
    kmisgmylgeivrnilidftkrgllfrgriserlktrgifetkflsqiesdclallqvra
    ilqhlglestcddsiivkevctvvarraaqlcgagmaavvdrirenrgldalkvtvgvdg
    tlyklhphfakvmhetvkdlapkcdvsflqsedgsgkgaalitavacrire