PDB entry 5heh

View 5heh on RCSB PDB site
Description: pentameric ligand-gated ion channel glic mutant p246a
Deposited on 2016-01-06, released 2016-03-02
The last revision was dated 2016-03-16, with a file datestamp of 2016-03-11.
Experiment type: XRAY
Resolution: 3.3 Å
R-factor: N/A
AEROSPACI score: 0.09 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Proton-gated ion channel
    Species: Gloeobacter violaceus [TaxId:33072]
    Gene: glvI, glr4197
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q7NDN8 (Start-315)
      • engineered mutation (245)
  • Chain 'B':
    Compound: Proton-gated ion channel
    Species: Gloeobacter violaceus [TaxId:33072]
    Gene: glvI, glr4197
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q7NDN8 (Start-315)
      • engineered mutation (245)
  • Chain 'C':
    Compound: Proton-gated ion channel
    Species: Gloeobacter violaceus [TaxId:33072]
    Gene: glvI, glr4197
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q7NDN8 (Start-315)
      • engineered mutation (245)
  • Chain 'D':
    Compound: Proton-gated ion channel
    Species: Gloeobacter violaceus [TaxId:33072]
    Gene: glvI, glr4197
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q7NDN8 (Start-315)
      • engineered mutation (245)
  • Chain 'E':
    Compound: Proton-gated ion channel
    Species: Gloeobacter violaceus [TaxId:33072]
    Gene: glvI, glr4197
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q7NDN8 (Start-315)
      • engineered mutation (245)

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >5hehA (A:)
    qdmvsppppiadepltvntgiyliecyslddkaetfkvnaflslswkdrrlafdpvrsgv
    rvktyepeaiwipeirfvnvenardadvvdisvspdgtvqylerfsarvlspldfrrypf
    dsqtlhiylivrsvdtrnivlavdlekvgknddvfltgwdiesftavvkpanfaledrle
    skldyqlrisrqyfsyipniilpmlfilfiswtafwstsyeanvtlvvstliahiafnil
    vetnlaktpymtytgaiifmiylfyfvavievtvqhylkvesqparaasitrasriafpv
    vfllaniilaflffgf
    

    Sequence, based on observed residues (ATOM records):
    >5hehA (A:)
    pppiadepltvntgiyliecyslddkaetfkvnaflslswkdrrlafdpvrsgvrvktye
    peaiwipeirfvnvenardadvvdisvspdgtvqylerfsarvlspldfrrypfdsqtlh
    iylivrsvdtrnivlavdlekvgknddvfltgwdiesftavvkpanfaledrleskldyq
    lrisrqyfsyipniilpmlfilfiswtafwstsyeanvtlvvstliahiafnilvetnla
    ktpymtytgaiifmiylfyfvavievtvqhylkvesqparaasitrasriafpvvfllan
    iilaflffgf
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >5hehB (B:)
    qdmvsppppiadepltvntgiyliecyslddkaetfkvnaflslswkdrrlafdpvrsgv
    rvktyepeaiwipeirfvnvenardadvvdisvspdgtvqylerfsarvlspldfrrypf
    dsqtlhiylivrsvdtrnivlavdlekvgknddvfltgwdiesftavvkpanfaledrle
    skldyqlrisrqyfsyipniilpmlfilfiswtafwstsyeanvtlvvstliahiafnil
    vetnlaktpymtytgaiifmiylfyfvavievtvqhylkvesqparaasitrasriafpv
    vfllaniilaflffgf
    

    Sequence, based on observed residues (ATOM records):
    >5hehB (B:)
    pppiadepltvntgiyliecyslddkaetfkvnaflslswkdrrlafdpvrsgvrvktye
    peaiwipeirfvnvenardadvvdisvspdgtvqylerfsarvlspldfrrypfdsqtlh
    iylivrsvdtrnivlavdlekvgknddvfltgwdiesftavvkpanfaledrleskldyq
    lrisrqyfsyipniilpmlfilfiswtafwstsyeanvtlvvstliahiafnilvetnla
    ktpymtytgaiifmiylfyfvavievtvqhylkvesqparaasitrasriafpvvfllan
    iilaflffgf
    

  • Chain 'C':
    Sequence, based on SEQRES records:
    >5hehC (C:)
    qdmvsppppiadepltvntgiyliecyslddkaetfkvnaflslswkdrrlafdpvrsgv
    rvktyepeaiwipeirfvnvenardadvvdisvspdgtvqylerfsarvlspldfrrypf
    dsqtlhiylivrsvdtrnivlavdlekvgknddvfltgwdiesftavvkpanfaledrle
    skldyqlrisrqyfsyipniilpmlfilfiswtafwstsyeanvtlvvstliahiafnil
    vetnlaktpymtytgaiifmiylfyfvavievtvqhylkvesqparaasitrasriafpv
    vfllaniilaflffgf
    

    Sequence, based on observed residues (ATOM records):
    >5hehC (C:)
    pppiadepltvntgiyliecyslddkaetfkvnaflslswkdrrlafdpvrsgvrvktye
    peaiwipeirfvnvenardadvvdisvspdgtvqylerfsarvlspldfrrypfdsqtlh
    iylivrsvdtrnivlavdlekvgknddvfltgwdiesftavvkpanfaledrleskldyq
    lrisrqyfsyipniilpmlfilfiswtafwstsyeanvtlvvstliahiafnilvetnla
    ktpymtytgaiifmiylfyfvavievtvqhylkvesqparaasitrasriafpvvfllan
    iilaflffgf
    

  • Chain 'D':
    Sequence, based on SEQRES records:
    >5hehD (D:)
    qdmvsppppiadepltvntgiyliecyslddkaetfkvnaflslswkdrrlafdpvrsgv
    rvktyepeaiwipeirfvnvenardadvvdisvspdgtvqylerfsarvlspldfrrypf
    dsqtlhiylivrsvdtrnivlavdlekvgknddvfltgwdiesftavvkpanfaledrle
    skldyqlrisrqyfsyipniilpmlfilfiswtafwstsyeanvtlvvstliahiafnil
    vetnlaktpymtytgaiifmiylfyfvavievtvqhylkvesqparaasitrasriafpv
    vfllaniilaflffgf
    

    Sequence, based on observed residues (ATOM records):
    >5hehD (D:)
    pppiadepltvntgiyliecyslddkaetfkvnaflslswkdrrlafdpvrsgvrvktye
    peaiwipeirfvnvenardadvvdisvspdgtvqylerfsarvlspldfrrypfdsqtlh
    iylivrsvdtrnivlavdlekvgknddvfltgwdiesftavvkpanfaledrleskldyq
    lrisrqyfsyipniilpmlfilfiswtafwstsyeanvtlvvstliahiafnilvetnla
    ktpymtytgaiifmiylfyfvavievtvqhylkvesqparaasitrasriafpvvfllan
    iilaflffgf
    

  • Chain 'E':
    Sequence, based on SEQRES records:
    >5hehE (E:)
    qdmvsppppiadepltvntgiyliecyslddkaetfkvnaflslswkdrrlafdpvrsgv
    rvktyepeaiwipeirfvnvenardadvvdisvspdgtvqylerfsarvlspldfrrypf
    dsqtlhiylivrsvdtrnivlavdlekvgknddvfltgwdiesftavvkpanfaledrle
    skldyqlrisrqyfsyipniilpmlfilfiswtafwstsyeanvtlvvstliahiafnil
    vetnlaktpymtytgaiifmiylfyfvavievtvqhylkvesqparaasitrasriafpv
    vfllaniilaflffgf
    

    Sequence, based on observed residues (ATOM records):
    >5hehE (E:)
    pppiadepltvntgiyliecyslddkaetfkvnaflslswkdrrlafdpvrsgvrvktye
    peaiwipeirfvnvenardadvvdisvspdgtvqylerfsarvlspldfrrypfdsqtlh
    iylivrsvdtrnivlavdlekvgknddvfltgwdiesftavvkpanfaledrleskldyq
    lrisrqyfsyipniilpmlfilfiswtafwstsyeanvtlvvstliahiafnilvetnla
    ktpymtytgaiifmiylfyfvavievtvqhylkvesqparaasitrasriafpvvfllan
    iilaflffgf