PDB entry 5hed

View 5hed on RCSB PDB site
Description: the third pdz domain from the synaptic protein psd-95 in complex with a mutant c-terminal peptide derived from cript (t-2f)
Deposited on 2016-01-05, released 2016-11-16
The last revision was dated 2016-11-16, with a file datestamp of 2016-11-11.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: N/A
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Disks large homolog 4
    Species: Rattus norvegicus [TaxId:10116]
    Gene: DLG4, DLGH4, PSD95
    Database cross-references and differences (RAF-indexed):
    • Uniprot P31016 (5-105)
      • expression tag (1-4)
      • expression tag (106-118)
  • Chain 'B':
    Compound: Cysteine-rich PDZ-binding protein
    Species: RATTUS NORVEGICUS, synthetic [TaxId:10116]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q792Q4 (Start-8)
      • engineered mutation (6)
  • Heterogens: HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >5hedA (A:)
    gspeflgeedipreprrivihrgstglgfnivggedgegifisfilaggpadlsgelrkg
    dqilsvngvdlrnasheqaaialknagqtvtiiaqykpeeysrfeansrvdssgrivtd
    

    Sequence, based on observed residues (ATOM records):
    >5hedA (A:)
    speflgeedipreprrivihrgstglgfnivggedgegifisfilaggpadlsgelrkgd
    qilsvngvdlrnasheqaaialknagqtvtiiaqykpeeysrfeansrvdssgrivtd
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >5hedB (B:)
    tknykqfsv
    

    Sequence, based on observed residues (ATOM records):
    >5hedB (B:)
    knykqfsv