PDB entry 5heb

View 5heb on RCSB PDB site
Description: the third pdz domain from the synaptic protein psd-95 in complex with a c-terminal peptide derived from cript
Deposited on 2016-01-05, released 2016-11-16
The last revision was dated 2017-09-27, with a file datestamp of 2017-09-22.
Experiment type: XRAY
Resolution: 1.6500000000000001 Å
R-factor: N/A
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Disks large homolog 4
    Species: Rattus norvegicus [TaxId:10116]
    Gene: DLG4, DLGH4, PSD95
    Database cross-references and differences (RAF-indexed):
    • Uniprot P31016 (5-105)
      • expression tag (0-4)
      • expression tag (106-118)
  • Chain 'B':
    Compound: Cysteine-rich PDZ-binding protein
    Species: RATTUS NORVEGICUS, synthetic [TaxId:10116]
    Database cross-references and differences (RAF-indexed):
  • Heterogens: GOL, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >5hebA (A:)
    gspeflgeedipreprrivihrgstglgfnivggedgegifisfilaggpadlsgelrkg
    dqilsvngvdlrnasheqaaialknagqtvtiiaqykpeeysrfeansrvdssgrivtd
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >5hebB (B:)
    tknykqtsv
    

    Sequence, based on observed residues (ATOM records):
    >5hebB (B:)
    nykqtsv