PDB entry 5hdp

View 5hdp on RCSB PDB site
Description: hydrolase stna mutant - s185a
Deposited on 2016-01-05, released 2017-01-11
The last revision was dated 2017-01-25, with a file datestamp of 2017-01-20.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: N/A
AEROSPACI score: 0.15 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hydrolase
    Species: Streptomyces flocculus [TaxId:67300]
    Gene: stnA
    Database cross-references and differences (RAF-indexed):
    • Uniprot L7PIJ2 (Start-374)
      • engineered mutation (184)
      • expression tag (375)
  • Chain 'B':
    Compound: hydrolase
    Species: Streptomyces flocculus [TaxId:67300]
    Gene: stnA
    Database cross-references and differences (RAF-indexed):
    • Uniprot L7PIJ2 (Start-374)
      • engineered mutation (184)
      • expression tag (375)
  • Chain 'C':
    Compound: hydrolase
    Species: Streptomyces flocculus [TaxId:67300]
    Gene: stnA
    Database cross-references and differences (RAF-indexed):
    • Uniprot L7PIJ2 (Start-374)
      • engineered mutation (184)
      • expression tag (375)
  • Chain 'D':
    Compound: hydrolase
    Species: Streptomyces flocculus [TaxId:67300]
    Gene: stnA
    Database cross-references and differences (RAF-indexed):
    • Uniprot L7PIJ2 (Start-374)
      • engineered mutation (184)
      • expression tag (375)
  • Chain 'E':
    Compound: hydrolase
    Species: Streptomyces flocculus [TaxId:67300]
    Gene: stnA
    Database cross-references and differences (RAF-indexed):
    • Uniprot L7PIJ2 (Start-374)
      • engineered mutation (184)
      • expression tag (375)
  • Chain 'F':
    Compound: hydrolase
    Species: Streptomyces flocculus [TaxId:67300]
    Gene: stnA
    Database cross-references and differences (RAF-indexed):
    • Uniprot L7PIJ2 (Start-374)
      • engineered mutation (184)
      • expression tag (375)
  • Chain 'G':
    Compound: hydrolase
    Species: Streptomyces flocculus [TaxId:67300]
    Gene: stnA
    Database cross-references and differences (RAF-indexed):
    • Uniprot L7PIJ2 (Start-374)
      • engineered mutation (184)
      • expression tag (375)
  • Heterogens: STM, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >5hdpA (A:)
    vtalsrlgeppsghdgnsevrriamkratvpvlrrvaavcaaallvtvgtggpasatgtr
    saicrattvevtlgkgtgkmwgelcrpagsspdtvvtmvhgatynhnywdfpyqpdkysf
    rkmlngagyatfvvdrlgtgnstvppsselnltvearqmhevvqglrtgriggtgfgkvv
    lagyalgsavtsieastfhdvdavlitalghynnpagtqaiidnglspnddpvlkdrhhy
    ddgyattkpgsrkhvfyadrpmdpgvlatdeltkdanvfteaadplvidpavsraidvpv
    mfalgdrdplmcgdgyedcssqaalraqeapfwtsapsfdvilvedaghglnlvpntrvy
    qdasrdwldrvvghglehhhhhh
    

    Sequence, based on observed residues (ATOM records):
    >5hdpA (A:)
    saicrattvevtlgkgtgkmwgelcrpagsspdtvvtmvhgatynhnywdfpyqpdkysf
    rkmlngagyatfvvdrlgtgnstvppsselnltvearqmhevvqglrtgriggtgfgkvv
    lagyalgsavtsieastfhdvdavlitalghynnpagtqaiidnglspnddpvlkdrhhy
    ddgyattkpgsrkhvfyadrpmdpgvlatdeltkdanvfteaadplvidpavsraidvpv
    mfalgdrdplmcgdgyedcssqaalraqeapfwtsapsfdvilvedaghglnlvpntrvy
    qdasrdwldrvvghgl
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >5hdpB (B:)
    vtalsrlgeppsghdgnsevrriamkratvpvlrrvaavcaaallvtvgtggpasatgtr
    saicrattvevtlgkgtgkmwgelcrpagsspdtvvtmvhgatynhnywdfpyqpdkysf
    rkmlngagyatfvvdrlgtgnstvppsselnltvearqmhevvqglrtgriggtgfgkvv
    lagyalgsavtsieastfhdvdavlitalghynnpagtqaiidnglspnddpvlkdrhhy
    ddgyattkpgsrkhvfyadrpmdpgvlatdeltkdanvfteaadplvidpavsraidvpv
    mfalgdrdplmcgdgyedcssqaalraqeapfwtsapsfdvilvedaghglnlvpntrvy
    qdasrdwldrvvghglehhhhhh
    

    Sequence, based on observed residues (ATOM records):
    >5hdpB (B:)
    saicrattvevtlgkgtgkmwgelcrpagsspdtvvtmvhgatynhnywdfpyqpdkysf
    rkmlngagyatfvvdrlgtgnstvppsselnltvearqmhevvqglrtgriggtgfgkvv
    lagyalgsavtsieastfhdvdavlitalghynnpagtqaiidnglspnddpvlkdrhhy
    ddgyattkpgsrkhvfyadrpmdpgvlatdeltkdanvfteaadplvidpavsraidvpv
    mfalgdrdplmcgdgyedcssqaalraqeapfwtsapsfdvilvedaghglnlvpntrvy
    qdasrdwldrvvghgl
    

  • Chain 'C':
    Sequence, based on SEQRES records:
    >5hdpC (C:)
    vtalsrlgeppsghdgnsevrriamkratvpvlrrvaavcaaallvtvgtggpasatgtr
    saicrattvevtlgkgtgkmwgelcrpagsspdtvvtmvhgatynhnywdfpyqpdkysf
    rkmlngagyatfvvdrlgtgnstvppsselnltvearqmhevvqglrtgriggtgfgkvv
    lagyalgsavtsieastfhdvdavlitalghynnpagtqaiidnglspnddpvlkdrhhy
    ddgyattkpgsrkhvfyadrpmdpgvlatdeltkdanvfteaadplvidpavsraidvpv
    mfalgdrdplmcgdgyedcssqaalraqeapfwtsapsfdvilvedaghglnlvpntrvy
    qdasrdwldrvvghglehhhhhh
    

    Sequence, based on observed residues (ATOM records):
    >5hdpC (C:)
    saicrattvevtlgkgtgkmwgelcrpagsspdtvvtmvhgatynhnywdfpyqpdkysf
    rkmlngagyatfvvdrlgtgnstvppsselnltvearqmhevvqglrtgriggtgfgkvv
    lagyalgsavtsieastfhdvdavlitalghynnpagtqaiidnglspnddpvlkdrhhy
    ddgyattkpgsrkhvfyadrpmdpgvlatdeltkdanvfteaadplvidpavsraidvpv
    mfalgdrdplmcgdgyedcssqaalraqeapfwtsapsfdvilvedaghglnlvpntrvy
    qdasrdwldrvvghgl
    

  • Chain 'D':
    Sequence, based on SEQRES records:
    >5hdpD (D:)
    vtalsrlgeppsghdgnsevrriamkratvpvlrrvaavcaaallvtvgtggpasatgtr
    saicrattvevtlgkgtgkmwgelcrpagsspdtvvtmvhgatynhnywdfpyqpdkysf
    rkmlngagyatfvvdrlgtgnstvppsselnltvearqmhevvqglrtgriggtgfgkvv
    lagyalgsavtsieastfhdvdavlitalghynnpagtqaiidnglspnddpvlkdrhhy
    ddgyattkpgsrkhvfyadrpmdpgvlatdeltkdanvfteaadplvidpavsraidvpv
    mfalgdrdplmcgdgyedcssqaalraqeapfwtsapsfdvilvedaghglnlvpntrvy
    qdasrdwldrvvghglehhhhhh
    

    Sequence, based on observed residues (ATOM records):
    >5hdpD (D:)
    saicrattvevtlgkgtgkmwgelcrpagsspdtvvtmvhgatynhnywdfpyqpdkysf
    rkmlngagyatfvvdrlgtgnstvppsselnltvearqmhevvqglrtgriggtgfgkvv
    lagyalgsavtsieastfhdvdavlitalghynnpagtqaiidnglspnddpvlkdrhhy
    ddgyattkpgsrkhvfyadrpmdpgvlatdeltkdanvfteaadplvidpavsraidvpv
    mfalgdrdplmcgdgyedcssqaalraqeapfwtsapsfdvilvedaghglnlvpntrvy
    qdasrdwldrvvghgl
    

  • Chain 'E':
    Sequence, based on SEQRES records:
    >5hdpE (E:)
    vtalsrlgeppsghdgnsevrriamkratvpvlrrvaavcaaallvtvgtggpasatgtr
    saicrattvevtlgkgtgkmwgelcrpagsspdtvvtmvhgatynhnywdfpyqpdkysf
    rkmlngagyatfvvdrlgtgnstvppsselnltvearqmhevvqglrtgriggtgfgkvv
    lagyalgsavtsieastfhdvdavlitalghynnpagtqaiidnglspnddpvlkdrhhy
    ddgyattkpgsrkhvfyadrpmdpgvlatdeltkdanvfteaadplvidpavsraidvpv
    mfalgdrdplmcgdgyedcssqaalraqeapfwtsapsfdvilvedaghglnlvpntrvy
    qdasrdwldrvvghglehhhhhh
    

    Sequence, based on observed residues (ATOM records):
    >5hdpE (E:)
    saicrattvevtlgkgtgkmwgelcrpagsspdtvvtmvhgatynhnywdfpyqpdkysf
    rkmlngagyatfvvdrlgtgnstvppsselnltvearqmhevvqglrtgriggtgfgkvv
    lagyalgsavtsieastfhdvdavlitalghynnpagtqaiidnglspnddpvlkdrhhy
    ddgyattkpgsrkhvfyadrpmdpgvlatdeltkdanvfteaadplvidpavsraidvpv
    mfalgdrdplmcgdgyedcssqaalraqeapfwtsapsfdvilvedaghglnlvpntrvy
    qdasrdwldrvvghgl
    

  • Chain 'F':
    Sequence, based on SEQRES records:
    >5hdpF (F:)
    vtalsrlgeppsghdgnsevrriamkratvpvlrrvaavcaaallvtvgtggpasatgtr
    saicrattvevtlgkgtgkmwgelcrpagsspdtvvtmvhgatynhnywdfpyqpdkysf
    rkmlngagyatfvvdrlgtgnstvppsselnltvearqmhevvqglrtgriggtgfgkvv
    lagyalgsavtsieastfhdvdavlitalghynnpagtqaiidnglspnddpvlkdrhhy
    ddgyattkpgsrkhvfyadrpmdpgvlatdeltkdanvfteaadplvidpavsraidvpv
    mfalgdrdplmcgdgyedcssqaalraqeapfwtsapsfdvilvedaghglnlvpntrvy
    qdasrdwldrvvghglehhhhhh
    

    Sequence, based on observed residues (ATOM records):
    >5hdpF (F:)
    icrattvevtlgkgtgkmwgelcrpagsspdtvvtmvhgatynhnywdfpyqpdkysfrk
    mlngagyatfvvdrlgtgnstvppsselnltvearqmhevvqglrtgriggtgfgkvvla
    gyalgsavtsieastfhdvdavlitalghynnpagtqaiidnglspnddpvlkdrhhydd
    gyattkpgsrkhvfyadrpmdpgvlatdeltkdanvfteaadplvidpavsraidvpvmf
    algdrdplmcgdgyedcssqaalraqeapfwtsapsfdvilvedaghglnlvpntrvyqd
    asrdwldrvvghgl
    

  • Chain 'G':
    Sequence, based on SEQRES records:
    >5hdpG (G:)
    vtalsrlgeppsghdgnsevrriamkratvpvlrrvaavcaaallvtvgtggpasatgtr
    saicrattvevtlgkgtgkmwgelcrpagsspdtvvtmvhgatynhnywdfpyqpdkysf
    rkmlngagyatfvvdrlgtgnstvppsselnltvearqmhevvqglrtgriggtgfgkvv
    lagyalgsavtsieastfhdvdavlitalghynnpagtqaiidnglspnddpvlkdrhhy
    ddgyattkpgsrkhvfyadrpmdpgvlatdeltkdanvfteaadplvidpavsraidvpv
    mfalgdrdplmcgdgyedcssqaalraqeapfwtsapsfdvilvedaghglnlvpntrvy
    qdasrdwldrvvghglehhhhhh
    

    Sequence, based on observed residues (ATOM records):
    >5hdpG (G:)
    saicrattvevtlgkgtgkmwgelcrpagsspdtvvtmvhgatynhnywdfpyqpdkysf
    rkmlngagyatfvvdrlgtgnstvppsselnltvearqmhevvqglrtgriggtgfgkvv
    lagyalgsavtsieastfhdvdavlitalghynnpagtqaiidnglspnddpvlkdrhhy
    ddgyattkpgsrkhvfyadrpmdpgvlatdeltkdanvfteaadplvidpavsraidvpv
    mfalgdrdplmcgdgyedcssqaalraqeapfwtsapsfdvilvedaghglnlvpntrvy
    qdasrdwldrvvghgl