PDB entry 5hdl

View 5hdl on RCSB PDB site
Description: crystal structure of shaft pilin spaa from lactobacillus rhamnosus gg - e269a mutant
Deposited on 2016-01-05, released 2016-07-20
The last revision was dated 2016-07-20, with a file datestamp of 2016-07-15.
Experiment type: XRAY
Resolution: 2.39 Å
R-factor: N/A
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cell surface protein SpaA
    Species: Lactobacillus rhamnosus GG [TaxId:568703]
    Gene: LRHM_0426
    Database cross-references and differences (RAF-indexed):
    • Uniprot C7T9P4 (Start-274)
      • engineered mutation (241)
  • Chain 'B':
    Compound: Cell surface protein SpaA
    Species: Lactobacillus rhamnosus GG [TaxId:568703]
    Gene: LRHM_0426
    Database cross-references and differences (RAF-indexed):
    • Uniprot C7T9P4 (Start-274)
      • engineered mutation (241)
  • Chain 'C':
    Compound: Cell surface protein SpaA
    Species: Lactobacillus rhamnosus GG [TaxId:568703]
    Gene: LRHM_0426
    Database cross-references and differences (RAF-indexed):
    • Uniprot C7T9P4 (Start-274)
      • engineered mutation (241)
  • Heterogens: HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >5hdlA (A:)
    mgrdpnstndtttqnvvltkygfdkdvtaidratdqiwtgdgakplqgvdftiynvtany
    waspkdykgsfdsapvaatgttndkgqltqalpiqskdasgktraavylfhetnpragyn
    tsadfwltlpakaaadgnvyvypknvqkttyertfvkkdaetkevlegagfkisnsdgkf
    lkltdkdgqsvsigegfidvlannyrltwvaesdatvftsdksgkfglngfadntttyta
    vatnvpdgydaaantdfkadnsssdildapsgilplehhhhhh
    

    Sequence, based on observed residues (ATOM records):
    >5hdlA (A:)
    tttqnvvltkygfdkdvtaidratdqiwtgdgakplqgvdftiynvtanywaspkdykgs
    fdsapvaatgttndkgqltqalpiqskdasgktraavylfhetnpragyntsadfwltlp
    akaaadgnvyvypknvqkttyertfvkkdaetkevlegagfkisnsdgkflkltdkdgqs
    vsigegfidvlannyrltwvaesdatvftsdksgkfglngfadntttytavatnvpdgyd
    aaantdfkadnsssdildapsgilp
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >5hdlB (B:)
    mgrdpnstndtttqnvvltkygfdkdvtaidratdqiwtgdgakplqgvdftiynvtany
    waspkdykgsfdsapvaatgttndkgqltqalpiqskdasgktraavylfhetnpragyn
    tsadfwltlpakaaadgnvyvypknvqkttyertfvkkdaetkevlegagfkisnsdgkf
    lkltdkdgqsvsigegfidvlannyrltwvaesdatvftsdksgkfglngfadntttyta
    vatnvpdgydaaantdfkadnsssdildapsgilplehhhhhh
    

    Sequence, based on observed residues (ATOM records):
    >5hdlB (B:)
    tttqnvvltkygfdkdvtaidratdqiwtgdgakplqgvdftiynvtanywaspkdykgs
    fdsapvaatgttndkgqltqalpiqskdasgktraavylfhetnpragyntsadfwltlp
    akaaadgnvyvypknvqkttyertfvkkdaetkevlegagfkisnsdgkflkltdkdgqs
    vsigegfidvlannyrltwvaesdatvftsdksgkfglngfadntttytavatnvpdgyd
    aaantdfkadnsssdildapsgilp
    

  • Chain 'C':
    Sequence, based on SEQRES records:
    >5hdlC (C:)
    mgrdpnstndtttqnvvltkygfdkdvtaidratdqiwtgdgakplqgvdftiynvtany
    waspkdykgsfdsapvaatgttndkgqltqalpiqskdasgktraavylfhetnpragyn
    tsadfwltlpakaaadgnvyvypknvqkttyertfvkkdaetkevlegagfkisnsdgkf
    lkltdkdgqsvsigegfidvlannyrltwvaesdatvftsdksgkfglngfadntttyta
    vatnvpdgydaaantdfkadnsssdildapsgilplehhhhhh
    

    Sequence, based on observed residues (ATOM records):
    >5hdlC (C:)
    tttqnvvltkygfdkdvtaidratdqiwtgdgakplqgvdftiynvtanywaspkdykgs
    fdsapvaatgttndkgqltqalpiqskdasgktraavylfhetnpragyntsadfwltlp
    akaaadgnvyvypknvqkttyertfvkkdaetkevlegagfkisnsdgkflkltdkdgqs
    vsigegfidvlannyrltwvaesdatvftsdksgkfglngfadntttytavatnvpdgyd
    aaantdfkadnsssdildapsgilp