PDB entry 5hdj

View 5hdj on RCSB PDB site
Description: Structure of B. megaterium NfrA1
Class: oxidoreductase
Keywords: Nitroreductase enzyme, dimer, oxidoreductase
Deposited on 2016-01-05, released 2016-04-06
The last revision prior to the SCOPe 2.07 freeze date was dated 2016-06-01, with a file datestamp of 2016-05-27.
Experiment type: XRAY
Resolution: 1.89 Å
R-factor: N/A
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: NfrA1
    Species: Bacillus megaterium [TaxId:1404]
    Gene: nfrA1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5hdja_
  • Chain 'B':
    Compound: NfrA1
    Species: Bacillus megaterium [TaxId:1404]
    Gene: nfrA1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5hdjb_
  • Heterogens: FMN, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5hdjA (A:)
    mnsvietilnhrsirkyedkplseeqiqtivesaqaastssyiqaysiigvkdketkrkl
    aqlagnqpyvetnghffvfcadfhrhdviaemekkdlstalesteqfmvaiidvalaaqn
    atlaaesmglgacyigglrneleevskllklphhviplfgltvghpagitdkkprlpfkh
    vyheetyepndeqtkkeltayneeisayynertngkrqdtwtgqmaemlsnpkrmymkef
    vekqgfnkkkghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5hdjA (A:)
    nsvietilnhrsirkyedkplseeqiqtivesaqaastssyiqaysiigvkdketkrkla
    qlagnqpyvetnghffvfcadfhrhdviaemekkdlstalesteqfmvaiidvalaaqna
    tlaaesmglgacyigglrneleevskllklphhviplfgltvghpagitdkkprlpfkhv
    yheetyepndeqtkkeltayneeisayynertngkrqdtwtgqmaemlsnpkrmymkefv
    ekqgfnk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5hdjB (B:)
    mnsvietilnhrsirkyedkplseeqiqtivesaqaastssyiqaysiigvkdketkrkl
    aqlagnqpyvetnghffvfcadfhrhdviaemekkdlstalesteqfmvaiidvalaaqn
    atlaaesmglgacyigglrneleevskllklphhviplfgltvghpagitdkkprlpfkh
    vyheetyepndeqtkkeltayneeisayynertngkrqdtwtgqmaemlsnpkrmymkef
    vekqgfnkkkghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5hdjB (B:)
    mnsvietilnhrsirkyedkplseeqiqtivesaqaastssyiqaysiigvkdketkrkl
    aqlagnqpyvetnghffvfcadfhrhdviaemekkdlstalesteqfmvaiidvalaaqn
    atlaaesmglgacyigglrneleevskllklphhviplfgltvghpagitdkkprlpfkh
    vyheetyepndeqtkkeltayneeisayynertngkrqdtwtgqmaemlsnpkrmymkef
    vekqgfnk