PDB entry 5hdi

View 5hdi on RCSB PDB site
Description: Structural characterization of CYP144A1, a Mycobacterium tuberculosis cytochrome P450
Class: oxidoreductase
Keywords: monooxygenase, cytochrome P450, heme-binding, oxidoreductase
Deposited on 2016-01-05, released 2016-05-04
The last revision prior to the SCOPe 2.07 freeze date was dated 2016-06-08, with a file datestamp of 2016-06-03.
Experiment type: XRAY
Resolution: 1.54 Å
R-factor: N/A
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cytochrome P450 144
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: cyp144, Rv1777, MTCY25C11.04
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5hdia_
  • Chain 'B':
    Compound: Cytochrome P450 144
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: cyp144, Rv1777, MTCY25C11.04
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5hdib_
  • Heterogens: HEM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5hdiA (A:)
    mtiakdantffgaesvqdpyplyermraagsvhriansdfyavcgwdavneaigrpedfs
    snltatmtytaegtakpfemdplggpthvlataddpahavhrklvlrhlaakrirvmeqf
    tvqaadrlwvdgmqdgciewmgamanrlpmmvvaeliglpdpdiaqlvkwgyaatqlleg
    lvendqlvaagvalmelsgyifeqfdraaadprdnllgelatacasgeldtltaqvmmvt
    lfaaggestaallgsavwilatrpdiqqqvranpellgafieetlryeppfrghyrhvrn
    attldgtelpadshllllwgaanrdpaqfeapgefrldraggkghisfgkgahfcvgaal
    arlearivlrllldrtsvieaadvggwlpsilvrrierlelavq
    

    Sequence, based on observed residues (ATOM records): (download)
    >5hdiA (A:)
    dantffgaesvqdpyplyermraagsvhriansdfyavcgwdavneaigrpedfssnlta
    tmtytaegtakpfemdplggpthvlataddpahavhrklvlrhlaakrirvmeqftvqaa
    drlwvdgmqdgciewmgamanrlpmmvvaeliglpdpdiaqlvkwgyaatqlleglvend
    qlvaagvalmelsgyifeqfdraaadprdnllgelatacasgeldtltaqvmmvtlfaag
    gestaallgsavwilatrpdiqqqvranpellgafieetlryeppfrghyrhvrnattld
    gtelpadshllllwgaanrdpaqfeapgefrldrakghisfgkgahfcvgaalarleari
    vlrllldrtsvieaadvggwlpsilvrrierlelavq
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5hdiB (B:)
    mtiakdantffgaesvqdpyplyermraagsvhriansdfyavcgwdavneaigrpedfs
    snltatmtytaegtakpfemdplggpthvlataddpahavhrklvlrhlaakrirvmeqf
    tvqaadrlwvdgmqdgciewmgamanrlpmmvvaeliglpdpdiaqlvkwgyaatqlleg
    lvendqlvaagvalmelsgyifeqfdraaadprdnllgelatacasgeldtltaqvmmvt
    lfaaggestaallgsavwilatrpdiqqqvranpellgafieetlryeppfrghyrhvrn
    attldgtelpadshllllwgaanrdpaqfeapgefrldraggkghisfgkgahfcvgaal
    arlearivlrllldrtsvieaadvggwlpsilvrrierlelavq
    

    Sequence, based on observed residues (ATOM records): (download)
    >5hdiB (B:)
    tffgaesvqdpyplyermraagsvhriansdfyavcgwdavneaigrpedfssnltatmt
    ytaegtakpfemdplggpthvlataddpahavhrklvlrhlaakrirvmeqftvqaadrl
    wvdgmqdgciewmgamanrlpmmvvaeliglpdpdiaqlvkwgyaatqlleglvendqlv
    aagvalmelsgyifeqfdraaadprdnllgelatacasgeldtltaqvmmvtlfaagges
    taallgsavwilatrpdiqqqvranpellgafieetlryeppfrghyrhvrnattldgte
    lpadshllllwgaanrdpaqfeapgefrldrkghisfgkgahfcvgaalarlearivlrl
    lldrtsvieaadvggwlpsilvrrierlelavq