PDB entry 5hd8

View 5hd8 on RCSB PDB site
Description: Crystal structure of disulfide cross-linked D417C ClC-ec1
Class: transport protein
Keywords: antiporter, membrane exchanger, TRANSPORT PROTEIN
Deposited on 2016-01-05, released 2017-01-18
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-09-27, with a file datestamp of 2017-09-22.
Experiment type: XRAY
Resolution: 3.15 Å
R-factor: N/A
AEROSPACI score: 0.12 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: H(+)/Cl(-) exchange transporter clcA
    Species: Escherichia coli [TaxId:83333]
    Gene: clcA, eriC, yadQ, b0155, JW5012
    Database cross-references and differences (RAF-indexed):
    • Uniprot P37019 (1-End)
      • engineered mutation (401)
    Domains in SCOPe 2.07: d5hd8a_
  • Chain 'B':
    Compound: H(+)/Cl(-) exchange transporter clcA
    Species: Escherichia coli [TaxId:83333]
    Gene: clcA, eriC, yadQ, b0155, JW5012
    Database cross-references and differences (RAF-indexed):
    • Uniprot P37019
      • engineered mutation (401)
    Domains in SCOPe 2.07: d5hd8b_
  • Chain 'C':
    Compound: Fab Fragment (Heavy Chain)
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 5HD8 (Start-221)
  • Chain 'D':
    Compound: Fab Fragment (Light Chain)
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 5HD8 (0-210)
    Domains in SCOPe 2.07: d5hd8d1, d5hd8d2
  • Chain 'E':
    Compound: Fab Fragment (Heavy Chain)
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 5HD8
  • Chain 'F':
    Compound: Fab Fragment (Light Chain)
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 5HD8 (0-210)
    Domains in SCOPe 2.07: d5hd8f1, d5hd8f2
  • Heterogens: CL

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5hd8A (A:)
    mrrrqlirqllerdktplailfmaavvgtlvglaavafdkgvawlqnqrmgalvhtadny
    pllltvaflcsavlamfgyflvrkyapeaggsgipeiegaledqrpvrwwrvlpvkffgg
    lgtlgggmvlgregptvqiggnigrmvldifrlkgdearhtllatgaaaglaaafnapla
    gilfiieemrpqfrytlisikavfigvimstimyrifnhevalidvgklsdaplntlwly
    lilgiifgifgpifnkwvlgmqdllhrvhggnitkwvlmggaigglcgllgfvapatsgg
    gfnlipiatagnfsmgmlvfifvarvittllcfssgapggifapmlalgtvlgtafgmva
    velfpqyhleagtfaiagmgallaasirapltgiilvlemtcnyqlilpmiitglgatll
    aqftggkplysailartlakqeaeqlarsk
    

    Sequence, based on observed residues (ATOM records): (download)
    >5hd8A (A:)
    rrrqlirqllerdktplailfmaavvgtlvglaavafdkgvawlqnqrmgalvhtadnyp
    llltvaflcsavlamfgyflvrkyapeaggsgipeiegaledqrpvrwwrvlpvkffggl
    gtlgggmvlgregptvqiggnigrmvldifrlkgdearhtllatgaaaglaaafnaplag
    ilfiieemrpqfrytlisikavfigvimstimyrifnhlsdaplntlwlylilgiifgif
    gpifnkwvlgmqdllhrvhggnitkwvlmggaigglcgllgfvapatsgggfnlipiata
    gnfsmgmlvfifvarvittllcfssgapggifapmlalgtvlgtafgmvavelfpqyhle
    agtfaiagmgallaasirapltgiilvlemtcnyqlilpmiitglgatllaqftggkply
    sailartlakqea
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5hd8B (B:)
    mrrrqlirqllerdktplailfmaavvgtlvglaavafdkgvawlqnqrmgalvhtadny
    pllltvaflcsavlamfgyflvrkyapeaggsgipeiegaledqrpvrwwrvlpvkffgg
    lgtlgggmvlgregptvqiggnigrmvldifrlkgdearhtllatgaaaglaaafnapla
    gilfiieemrpqfrytlisikavfigvimstimyrifnhevalidvgklsdaplntlwly
    lilgiifgifgpifnkwvlgmqdllhrvhggnitkwvlmggaigglcgllgfvapatsgg
    gfnlipiatagnfsmgmlvfifvarvittllcfssgapggifapmlalgtvlgtafgmva
    velfpqyhleagtfaiagmgallaasirapltgiilvlemtcnyqlilpmiitglgatll
    aqftggkplysailartlakqeaeqlarsk
    

    Sequence, based on observed residues (ATOM records): (download)
    >5hd8B (B:)
    rrqlirqllerdktplailfmaavvgtlvglaavafdkgvawlqnqrmgalvhtadnypl
    lltvaflcsavlamfgyflvrkyapeaggsgipeiegaledqrpvrwwrvlpvkffgglg
    tlgggmvlgregptvqiggnigrmvldifrlkgdearhtllatgaaaglaaafnaplagi
    lfiieemrpqfrytlisikavfigvimstimyrifnklsdaplntlwlylilgiifgifg
    pifnkwvlgmqdllhrvhggnitkwvlmggaigglcgllgfvapatsgggfnlipiatag
    nfsmgmlvfifvarvittllcfssgapggifapmlalgtvlgtafgmvavelfpqyhlea
    gtfaiagmgallaasirapltgiilvlemtcnyqlilpmiitglgatllaqftggkplys
    ailartlakqea
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5hd8D (D:)
    divltqspaimsaapgdkvtmtcsasssvsyihwyqqksgtspkrwiydtskltsgvpvr
    fsgsgsgtsysltintmeaedaatyycqqwsshpqtfgggtkleilradaaptvsifpps
    seqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstltl
    tkdeyerhnsytceathktstspivksfnra
    

  • Chain 'E':
    No sequence available.

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5hd8F (F:)
    divltqspaimsaapgdkvtmtcsasssvsyihwyqqksgtspkrwiydtskltsgvpvr
    fsgsgsgtsysltintmeaedaatyycqqwsshpqtfgggtkleilradaaptvsifpps
    seqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstltl
    tkdeyerhnsytceathktstspivksfnra