PDB entry 5hd6

View 5hd6 on RCSB PDB site
Description: High resolution structure of 3-hydroxydecanoyl-(acyl carrier protein) dehydratase from Yersinia pestis at 1.35 A
Class: lyase
Keywords: Structural Genomics, PSI-Biology, Midwest Center for Structural Genomics, MCSG, Center for Structural Genomics of Infectious Diseases, CSGID, LYASE
Deposited on 2016-01-04, released 2016-01-20
The last revision prior to the SCOPe 2.07 freeze date was dated 2016-01-20, with a file datestamp of 2016-01-15.
Experiment type: XRAY
Resolution: 1.35 Å
R-factor: N/A
AEROSPACI score: 0.56 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 3-hydroxydecanoyl-[acyl-carrier-protein] dehydratase
    Species: Yersinia pestis CO92 [TaxId:214092]
    Gene: fabA, AK38_1122
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5hd6a1, d5hd6a2
  • Chain 'B':
    Compound: 3-hydroxydecanoyl-[acyl-carrier-protein] dehydratase
    Species: Yersinia pestis CO92 [TaxId:214092]
    Gene: fabA, AK38_1122
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5hd6b1, d5hd6b2
  • Chain 'C':
    Compound: 3-hydroxydecanoyl-[acyl-carrier-protein] dehydratase
    Species: Yersinia pestis CO92 [TaxId:214092]
    Gene: fabA, AK38_1122
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5hd6c1, d5hd6c2
  • Chain 'D':
    Compound: 3-hydroxydecanoyl-[acyl-carrier-protein] dehydratase
    Species: Yersinia pestis CO92 [TaxId:214092]
    Gene: fabA, AK38_1122
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5hd6d1, d5hd6d2
  • Chain 'E':
    Compound: 3-hydroxydecanoyl-[acyl-carrier-protein] dehydratase
    Species: Yersinia pestis CO92 [TaxId:214092]
    Gene: fabA, AK38_1122
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5hd6e1, d5hd6e2
  • Chain 'F':
    Compound: 3-hydroxydecanoyl-[acyl-carrier-protein] dehydratase
    Species: Yersinia pestis CO92 [TaxId:214092]
    Gene: fabA, AK38_1122
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5hd6f_
  • Chain 'G':
    Compound: 3-hydroxydecanoyl-[acyl-carrier-protein] dehydratase
    Species: Yersinia pestis CO92 [TaxId:214092]
    Gene: fabA, AK38_1122
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5hd6g_
  • Chain 'H':
    Compound: 3-hydroxydecanoyl-[acyl-carrier-protein] dehydratase
    Species: Yersinia pestis CO92 [TaxId:214092]
    Gene: fabA, AK38_1122
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5hd6h1, d5hd6h2
  • Heterogens: GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5hd6A (A:)
    snamvdkresytkedleasgrgelfgaggpplpagnmlmmdrivkmiedggshnkgyvea
    eldinpdlwffgchfigdpvmpgclgldamwqlvgfylgwlggegkgralgvgevkftgq
    vlpdakkvtyrinfkrvimrklimgvadgevlvdgkviytatdlkvglfkdtnaf
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5hd6B (B:)
    snamvdkresytkedleasgrgelfgaggpplpagnmlmmdrivkmiedggshnkgyvea
    eldinpdlwffgchfigdpvmpgclgldamwqlvgfylgwlggegkgralgvgevkftgq
    vlpdakkvtyrinfkrvimrklimgvadgevlvdgkviytatdlkvglfkdtnaf
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5hd6C (C:)
    snamvdkresytkedleasgrgelfgaggpplpagnmlmmdrivkmiedggshnkgyvea
    eldinpdlwffgchfigdpvmpgclgldamwqlvgfylgwlggegkgralgvgevkftgq
    vlpdakkvtyrinfkrvimrklimgvadgevlvdgkviytatdlkvglfkdtnaf
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5hd6D (D:)
    snamvdkresytkedleasgrgelfgaggpplpagnmlmmdrivkmiedggshnkgyvea
    eldinpdlwffgchfigdpvmpgclgldamwqlvgfylgwlggegkgralgvgevkftgq
    vlpdakkvtyrinfkrvimrklimgvadgevlvdgkviytatdlkvglfkdtnaf
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >5hd6E (E:)
    snamvdkresytkedleasgrgelfgaggpplpagnmlmmdrivkmiedggshnkgyvea
    eldinpdlwffgchfigdpvmpgclgldamwqlvgfylgwlggegkgralgvgevkftgq
    vlpdakkvtyrinfkrvimrklimgvadgevlvdgkviytatdlkvglfkdtnaf
    

    Sequence, based on observed residues (ATOM records): (download)
    >5hd6E (E:)
    amvdkresytkedleasgrgelfgaggpplpagnmlmmdrivkmiedggshnkgyveael
    dinpdlwffgchfigdpvmpgclgldamwqlvgfylgwlggegkgralgvgevkftgqvl
    pdakkvtyrinfkrvimrklimgvadgevlvdgkviytatdlkvglfkdtnaf
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >5hd6F (F:)
    snamvdkresytkedleasgrgelfgaggpplpagnmlmmdrivkmiedggshnkgyvea
    eldinpdlwffgchfigdpvmpgclgldamwqlvgfylgwlggegkgralgvgevkftgq
    vlpdakkvtyrinfkrvimrklimgvadgevlvdgkviytatdlkvglfkdtnaf
    

    Sequence, based on observed residues (ATOM records): (download)
    >5hd6F (F:)
    dkresytkedleasgrgelfgaggpplpagnmlmmdrivkmiedggshnkgyveaeldin
    pdlwffgchfigdpvmpgclgldamwqlvgfylgwlggegkgralgvgevkftgqvlpda
    kkvtyrinfkrvimrklimgvadgevlvdgkviytatdlkvglfkdtf
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >5hd6G (G:)
    snamvdkresytkedleasgrgelfgaggpplpagnmlmmdrivkmiedggshnkgyvea
    eldinpdlwffgchfigdpvmpgclgldamwqlvgfylgwlggegkgralgvgevkftgq
    vlpdakkvtyrinfkrvimrklimgvadgevlvdgkviytatdlkvglfkdtnaf
    

    Sequence, based on observed residues (ATOM records): (download)
    >5hd6G (G:)
    dkresytkedleasgrgelfgaggpplpagnmlmmdrivkmiedggshnkgyveaeldin
    pdlwffgchfigdpvmpgclgldamwqlvgfylgwlggegkgralgvgevkftgqvlpda
    kkvtyrinfkrvimrklimgvadgevlvdgkviytatdlkvglfkdtf
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >5hd6H (H:)
    snamvdkresytkedleasgrgelfgaggpplpagnmlmmdrivkmiedggshnkgyvea
    eldinpdlwffgchfigdpvmpgclgldamwqlvgfylgwlggegkgralgvgevkftgq
    vlpdakkvtyrinfkrvimrklimgvadgevlvdgkviytatdlkvglfkdtnaf
    

    Sequence, based on observed residues (ATOM records): (download)
    >5hd6H (H:)
    amvdkresytkedleasgrgelfgaggpplpagnmlmmdrivkmiedggshnkgyveael
    dinpdlwffgchfigdpvmpgclgldamwqlvgfylgwlggegkgralgvgevkftgqvl
    pdakkvtyrinfkrvimrklimgvadgevlvdgkviytatdlkvglfkdtnf