PDB entry 5hcy

View 5hcy on RCSB PDB site
Description: EGFR kinase domain mutant "TMLR" with 3-carboxamide azaindole compound 13
Class: transferase/transferase inhibitor
Keywords: protein kinase, inhibitor, TRANSFERASE-TRANSFERASE INHIBITOR complex
Deposited on 2016-01-04, released 2016-09-07
The last revision prior to the SCOPe 2.07 freeze date was dated 2016-10-26, with a file datestamp of 2016-10-21.
Experiment type: XRAY
Resolution: 2.46 Å
R-factor: N/A
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Epidermal growth factor receptor
    Species: Homo sapiens [TaxId:9606]
    Gene: EGFR, ERBB, ERBB1, HER1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00533 (2-End)
      • engineered mutation (96)
      • engineered mutation (164)
    Domains in SCOPe 2.07: d5hcya_
  • Heterogens: SO4, 60D, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5hcyA (A:)
    gsgeapnqallrilketefkkikvlgsgafgtvykglwipegekvkipvaikelreatsp
    kankeildeayvmasvdnphvcrllgicltstvqlimqlmpfgclldyvrehkdnigsqy
    llnwcvqiakgmnyledrrlvhrdlaarnvlvktpqhvkitdfgrakllgaaaaeyhaeg
    gkvpikwmalesilhriythqsdvwsygvtvwelmtfgskpydgipaseissilekgerl
    pqppictidvymimvkcwmidadsrpkfreliiefskmardpqrylviqgdermhlpspt
    dsnfyralmdeedmddvvdadeylipqqgns
    

    Sequence, based on observed residues (ATOM records): (download)
    >5hcyA (A:)
    geapnqallrilketefkkikvlgsgafgtvykglwipegekvkipvaikelatspkank
    eildeayvmasvdnphvcrllgicltstvqlimqlmpfgclldyvrehkdnigsqyllnw
    cvqiakgmnyledrrlvhrdlaarnvlvktpqhvkitdfgrakllvpikwmalesilhri
    ythqsdvwsygvtvwelmtfgskpydgipaseissilekgerlpqppictidvymimvkc
    wmidadsrpkfreliiefskmardpqrylviqgdermhlpsptdsnfydmddvvdadeyl
    ip