PDB entry 5hci

View 5hci on RCSB PDB site
Description: gpn-loop gtpase npa3 in complex with gdp
Deposited on 2016-01-04, released 2016-01-20
The last revision was dated 2017-09-06, with a file datestamp of 2017-09-01.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: N/A
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: GPN-loop GTPase 1
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: NPA3, EPA1, GPN1, YJR072C, J1821
    Database cross-references and differences (RAF-indexed):
    • Uniprot P47122 (0-253)
      • expression tag (254-256)
  • Chain 'B':
    Compound: GPN-loop GTPase 1
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: NPA3, EPA1, GPN1, YJR072C, J1821
    Database cross-references and differences (RAF-indexed):
    • Uniprot P47122 (0-253)
      • expression tag (254-257)
  • Chain 'C':
    Compound: GPN-loop GTPase 1
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: NPA3, EPA1, GPN1, YJR072C, J1821
    Database cross-references and differences (RAF-indexed):
    • Uniprot P47122 (0-253)
      • expression tag (254-256)
  • Chain 'D':
    Compound: GPN-loop GTPase 1
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: NPA3, EPA1, GPN1, YJR072C, J1821
    Database cross-references and differences (RAF-indexed):
    • Uniprot P47122 (0-253)
      • expression tag (254-257)
  • Chain 'E':
    Compound: GPN-loop GTPase 1
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: NPA3, EPA1, GPN1, YJR072C, J1821
    Database cross-references and differences (RAF-indexed):
    • Uniprot P47122 (0-253)
      • expression tag (254-258)
  • Chain 'F':
    Compound: GPN-loop GTPase 1
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: NPA3, EPA1, GPN1, YJR072C, J1821
    Database cross-references and differences (RAF-indexed):
    • Uniprot P47122 (0-253)
      • expression tag (254-257)
  • Heterogens: GDP, MG, GOL, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >5hciA (A:)
    slstiicigmagsgkttfmqrlnshlraektppyvinldpavlrvpyganidirdsikyk
    kvmenyqlgpngaivtslnlfstkidqvirlveqkkdkfqnciidtpgqiecfvwsasga
    iitesfassfptviayivdtprnsspttfmsnmlyacsilyktklpmivvfnktdvckad
    fakewmtdfesfqaaikedqdgymsslvnsmslmleefysqldvvgvssftgdgfdefmq
    cvdkkvdeydqyykkhhhhhh
    

    Sequence, based on observed residues (ATOM records):
    >5hciA (A:)
    slstiicigmagsgkttfmqrlnshlraektppyvinldpavlrvpyganidirdsikyk
    kvmenyqlgpngaivtslnlfstkidqvirlveqkkdkfqnciidtpgqiecfvwsasga
    iitesfassfptviayivdtprnsspttfmsnmlyacsilyktklpmivvfnktdvckad
    fakewmtdfesfqaaikedqdgymsslvnsmslmleefysqldvvgvssftgdgfdefmq
    cvdkkvdeydqyykkhh
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >5hciB (B:)
    slstiicigmagsgkttfmqrlnshlraektppyvinldpavlrvpyganidirdsikyk
    kvmenyqlgpngaivtslnlfstkidqvirlveqkkdkfqnciidtpgqiecfvwsasga
    iitesfassfptviayivdtprnsspttfmsnmlyacsilyktklpmivvfnktdvckad
    fakewmtdfesfqaaikedqdgymsslvnsmslmleefysqldvvgvssftgdgfdefmq
    cvdkkvdeydqyykkhhhhhh
    

    Sequence, based on observed residues (ATOM records):
    >5hciB (B:)
    slstiicigmagsgkttfmqrlnshlraektppyvinldpavlrvpyganidirdsikyk
    kvmenyqlgpngaivtslnlfstkidqvirlveqkkdkfqnciidtpgqiecfvwsasga
    iitesfassfptviayivdtprnsspttfmsnmlyacsilyktklpmivvfnktdvckad
    fakewmtdfesfqaaikedqdgymsslvnsmslmleefysqldvvgvssftgdgfdefmq
    cvdkkvdeydqyykkhhh
    

  • Chain 'C':
    Sequence, based on SEQRES records:
    >5hciC (C:)
    slstiicigmagsgkttfmqrlnshlraektppyvinldpavlrvpyganidirdsikyk
    kvmenyqlgpngaivtslnlfstkidqvirlveqkkdkfqnciidtpgqiecfvwsasga
    iitesfassfptviayivdtprnsspttfmsnmlyacsilyktklpmivvfnktdvckad
    fakewmtdfesfqaaikedqdgymsslvnsmslmleefysqldvvgvssftgdgfdefmq
    cvdkkvdeydqyykkhhhhhh
    

    Sequence, based on observed residues (ATOM records):
    >5hciC (C:)
    slstiicigmagsgkttfmqrlnshlraektppyvinldpavlrvpyganidirdsikpn
    gaivtslnlfstkidqvirlveqkkdkfqnciidtpgqiecfvwsasgaiitesfassfp
    tviayivdtprnsspttfmsnmlyacsilyktklpmivvfnktdvckadfakewmtdfes
    fqaaikedqdgymsslvnsmslmleefysqldvvgvssftgdgfdefmqcvdkkvdeydq
    yykkhh
    

  • Chain 'D':
    Sequence, based on SEQRES records:
    >5hciD (D:)
    slstiicigmagsgkttfmqrlnshlraektppyvinldpavlrvpyganidirdsikyk
    kvmenyqlgpngaivtslnlfstkidqvirlveqkkdkfqnciidtpgqiecfvwsasga
    iitesfassfptviayivdtprnsspttfmsnmlyacsilyktklpmivvfnktdvckad
    fakewmtdfesfqaaikedqdgymsslvnsmslmleefysqldvvgvssftgdgfdefmq
    cvdkkvdeydqyykkhhhhhh
    

    Sequence, based on observed residues (ATOM records):
    >5hciD (D:)
    slstiicigmagsgkttfmqrlnshlraektppyvinldpavlrvpyganidirdsikyk
    kvmenyqlgpngaivtslnlfstkidqvirlveqkkdkfqnciidtpgqiecfvwsasga
    iitesfassfptviayivdtprnsspttfmsnmlyacsilyktklpmivvfnktdvckad
    fakewmtdfesfqaaikedqdgymsslvnsmslmleefysqldvvgvssftgdgfdefmq
    cvdkkvdeydqyykkhhh
    

  • Chain 'E':
    Sequence, based on SEQRES records:
    >5hciE (E:)
    slstiicigmagsgkttfmqrlnshlraektppyvinldpavlrvpyganidirdsikyk
    kvmenyqlgpngaivtslnlfstkidqvirlveqkkdkfqnciidtpgqiecfvwsasga
    iitesfassfptviayivdtprnsspttfmsnmlyacsilyktklpmivvfnktdvckad
    fakewmtdfesfqaaikedqdgymsslvnsmslmleefysqldvvgvssftgdgfdefmq
    cvdkkvdeydqyykkhhhhhh
    

    Sequence, based on observed residues (ATOM records):
    >5hciE (E:)
    slstiicigmagsgkttfmqrlnshlraektppyvinldpavlrvpyganidirdsikyk
    kvmenyqlgpngaivtslnlfstkidqvirlveqkkdkfqnciidtpgqiecfvwsasga
    iitesfassfptviayivdtprnsspttfmsnmlyacsilyktklpmivvfnktdvckad
    fakewmtdfesfqaaikedqdgymsslvnsmslmleefysqldvvgvssftgdgfdefmq
    cvdkkvdeydqyykkhhhh
    

  • Chain 'F':
    Sequence, based on SEQRES records:
    >5hciF (F:)
    slstiicigmagsgkttfmqrlnshlraektppyvinldpavlrvpyganidirdsikyk
    kvmenyqlgpngaivtslnlfstkidqvirlveqkkdkfqnciidtpgqiecfvwsasga
    iitesfassfptviayivdtprnsspttfmsnmlyacsilyktklpmivvfnktdvckad
    fakewmtdfesfqaaikedqdgymsslvnsmslmleefysqldvvgvssftgdgfdefmq
    cvdkkvdeydqyykkhhhhhh
    

    Sequence, based on observed residues (ATOM records):
    >5hciF (F:)
    slstiicigmagsgkttfmqrlnshlraektppyvinldpavlrvpyganidirdsiklg
    pngaivtslnlfstkidqvirlveqkkdkfqnciidtpgqiecfvwsasgaiitesfass
    fptviayivdtprnsspttfmsnmlyacsilyktklpmivvfnktdvckadfakewmtdf
    esfqaaikedqdgymsslvnsmslmleefysqldvvgvssftgdgfdefmqcvdkkvdey
    dqyykkhhh