PDB entry 5hce

View 5hce on RCSB PDB site
Description: ternary complex of human complement c5 with ornithodoros moubata omci and rhipicephalus appendiculatus raci1
Deposited on 2016-01-04, released 2016-03-30
The last revision was dated 2020-07-29, with a file datestamp of 2020-06-29.
Experiment type: XRAY
Resolution: 3.12 Å
R-factor: N/A
AEROSPACI score: 0.19 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Complement C5
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: Complement C5
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: complement inhibitor
    Species: ORNITHODOROS MOUBATA [TaxId:6938]
    Gene: CI
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5YD59 (Start-164)
      • engineered mutation (74)
      • engineered mutation (98)
  • Chain 'D':
    Compound: Rhipicephalus appendiculatus RaCI1
    Species: Rhipicephalus appendiculatus [TaxId:34631]
    Database cross-references and differences (RAF-indexed):
    • PDB 5HCE
  • Heterogens: CYS

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >5hceA (A:)
    lqkkieeiaakykhsvvkkccydgacvnndetceqraarislgprcikafteccvvasql
    ranishkdmqlgrlhmktllpvskpeirsyfpeswlwevhlvprrkqlqfalpdslttwe
    iqgvgisntgicvadtvkakvfkdvflemnipysvvrgeqiqlkgtvynyrtsgmqfcvk
    msavegictsespvidhqgtksskcvrqkvegssshlvtftvlpleiglhninfsletwf
    gkeilvktlrvvpegvkresysgvtldprgiygtisrrkefpyripldlvpkteikrils
    vkgllvgeilsavlsqeginilthlpkgsaeaelmsvvpvfyvfhyletgnhwnifhsdp
    liekqklkkklkegmlsimsyrnadysysvwkggsastwltafalrvlgqvnkyveqnqn
    sicnsllwlvenyqldngsfkensqyqpiklqgtlpvearenslyltaftvigirkafdi
    cplvkidtalikadnfllentlpaqstftlaisayalslgdkthpqfrsivsalkrealv
    kgnppiyrfwkdnlqhkdssvpntgtarmvettayalltslnlkdinyvnpvikwlseeq
    rygggfystqdtinaieglteysllvkqlrlsmdidvsykhkgalhnykmtdknflgrpv
    evllnddlivstgfgsglatvhvttvvhktstseevcsfylkidtqdieashyrgygnsd
    ykrivacasykpsreesssgsshavmdislptgisaneedlkalvegvdqlftdyqikdg
    hvilqlnsipssdflcvrfrifelfevgflspatftvyeyhrpdkqctmfystsnikiqk
    vcegaackcveadcgqmqeeldltisaetrkqtackpeiayaykvsitsitvenvfvkyk
    atlldiyktgeavaekdseitfikkvtctnaelvkgrqylimgkealqikynfsfryiyp
    ldsltwieywprdttcsscqaflanldefaediflngc
    

    Sequence, based on observed residues (ATOM records):
    >5hceA (A:)
    lqkkieeiaakykhsvvkkccydgacvnndetceqraarislgprcikafteccvvasql
    ranishkdmqlgrlhmktllpvskpeirsyfpeswlwevhlvprrkqlqfalpdslttwe
    iqgvgisntgicvadtvkakvfkdvflemnipysvvrgeqiqlkgtvynyrtsgmqfcvk
    msavegictsespviksskcvrqkvegssshlvtftvlpleiglhninfsletwfgkeil
    vktlrvvpegvkresysgvtldprgiygtisrrkefpyripldlvpkteikrilsvkgll
    vgeilsavlsqeginilthlpkgsaeaelmsvvpvfyvfhyletgnhwnifhsdpliekq
    klkkklkegmlsimsyrnadysysvwkggsastwltafalrvlgqvnkyveqnqnsicns
    llwlvenyqldngsfkensqyqpiklqgtlpvearenslyltaftvigirkafdicplvk
    idtalikadnfllentlpaqstftlaisayalslgdkthpqfrsivsalkrealvkgnpp
    iyrfwkdnlqhkdssvpntgtarmvettayalltslnlkdinyvnpvikwlseeqryggg
    fystqdtinaieglteysllvkqlrlsmdidvsykhkgalhnykmtdknflgrpvevlln
    ddlivstgfgsglatvhvttvvhktstseevcsfylkidtqdieakrivacasykpsree
    sssgsshavmdislptgisaneedlkalvegvdqlftdyqikdghvilqlnsipssdflc
    vrfrifelfevgflspatftvyeyhrpdkqctmfystsnikiqkvcegaackcveadcgq
    mqeeldltisaetrkqtackpeiayaykvsitsitvenvfvkykatlldiyktgeavaek
    dseitfikkvtctnaelvkgrqylimgkealqikynfsfryiypldsltwieywprdttc
    sscqaflanldefaediflngc
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >5hceB (B:)
    qeqtyvisapkifrvgaseniviqvygyteafdatisiksypdkkfsyssghvhlssenk
    fqnsailtiqpkqlpggqnpvsyvylevvskhfskskrmpitydngflfihtdkpvytpd
    qsvkvrvyslnddlkpakretvltfidpegsevdmveeidhigiisfpdfkipsnprygm
    wtikakykedfsttgtayfevkeyvlphfsvsiepeynfigyknfknfeitikaryfynk
    vvteadvyitfgiredlkddqkemmqtamqntmlingiaqvtfdsetavkelsyysledl
    nnkylyiavtviestggfseeaeipgikyvlspyklnlvatplflkpgipypikvqvkds
    ldqlvggvpvtlnaqtidvnqetsdldpsksvtrvddgvasfvlnlpsgvtvlefnvktd
    apdlpeenqaregyraiaysslsqsylyidwtdnhkallvgehlniivtpkspyidkith
    ynylilskgkiihfgtrekfsdasyqsinipvtqnmvpssrllvyyivtgeqtaelvsds
    vwlnieekcgnqlqvhlspdadayspgqtvslnmatgmdswvalaavdsavygvqrgakk
    plervfqfleksdlgcgaggglnnanvfhlagltfltnanaddsqendepckeilr
    

    Sequence, based on observed residues (ATOM records):
    >5hceB (B:)
    eqtyvisapkifrvgaseniviqvygyteafdatisiksypdkkfsyssghvhlssenkf
    qnsailtiqpkqlpggqnpvsyvylevvskhfskskrmpitydngflfihtdkpvytpdq
    svkvrvyslnddlkpakretvltfidpegsevdmveeidhigiisfpdfkipsnprygmw
    tikakykedfsttgtayfevkeyvlphfsvsiepeynfigyknfknfeitikaryfynkv
    vteadvyitfgiredlkddqkemmqtamqntmlingiaqvtfdsetavkelsyysledln
    nkylyiavtviestggfseeaeipgikyvlspyklnlvatplflkpgipypikvqvkdsl
    dqlvggvpvtlnaqtidvnqetsdldpsksvtrvddgvasfvlnlpsgvtvlefnvktda
    pdlpeenqaregyraiaysslsqsylyidwtdnhkallvgehlniivtpkspyidkithy
    nylilskgkiihfgtrekfsdasyqsinipvtqnmvpssrllvyyivtgeqtaelvsdsv
    wlnieekcgnqlqvhlspdadayspgqtvslnmatgmdswvalaavdsavyglervfqfl
    eksdlgcgaggglnnanvfhlagltfltnanaddsqendepckeilr
    

  • Chain 'C':
    Sequence, based on SEQRES records:
    >5hceC (C:)
    mashhhhhhhhhhsgdsesdctgsepvdafqafsegkeayvlvrstdpkardclkgepag
    ekqdntlpvmmtfkqgtdwastdwtftldgakvtatlgqltqnrevvydsqshhchvdkv
    ekevpdyemwmldaggleveveccrqkleelasgrnqmyphlkdc
    

    Sequence, based on observed residues (ATOM records):
    >5hceC (C:)
    esdctgsepvdafqafsegkeayvlvrstdpkardclkgepagekqdntlpvmmtfkqgt
    dwastdwtftldgakvtatlgqltqnrevvydsqshhchvdkvekevpdyemwmldaggl
    eveveccrqkleelasgrnqmyphlkdc
    

  • Chain 'D':
    Sequence, based on SEQRES records:
    >5hceD (D:)
    gpmeevkttpipnhqcvnatcerkldalgnavitkcpqgclcvvrgasnivpangtcfql
    attkppmapgdnkdnkeeesn
    

    Sequence, based on observed residues (ATOM records):
    >5hceD (D:)
    qcvnatcerkldalgnavitkcpqgclcvvrgasnivpangtcfqla