PDB entry 5hc8

View 5hc8 on RCSB PDB site
Description: Crystal structure of lavandulyl diphosphate synthase from Lavandula x intermedia in complex with dimethylallyl diphosphate
Class: transferase
Keywords: substrate binding, prenyltransferase, substrate, TRANSFERASE
Deposited on 2016-01-04, released 2016-03-02
The last revision prior to the SCOPe 2.07 freeze date was dated 2016-04-13, with a file datestamp of 2016-04-08.
Experiment type: XRAY
Resolution: 1.87 Å
R-factor: N/A
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: prenyltransference for protein
    Species: Lavandula lanata [TaxId:39330]
    Database cross-references and differences (RAF-indexed):
    • PDB 5HC8
    Domains in SCOPe 2.07: d5hc8a_
  • Heterogens: MG, PIS, 61G, SO4, ISY, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5hc8A (A:)
    lagaeteidevtpnhvaiiidghrkwaksrgvtvqeghqtgvnnwkhiisrasqlgikll
    tiwalspqnfnrskmevdflmriyedflrsdvkelvtsqqdiqfsaigdksrlpeylqda
    isyaeglsqankgmhfilavayggrediveaarkiaakvehgilrpddideatfeqhlmt
    nitkfpspdlliraageqrlsnfflwqlpftefyftpklfpdfgeadlldalasyrcryr
    gfgerkgiheasawshpqfek
    

    Sequence, based on observed residues (ATOM records): (download)
    >5hc8A (A:)
    devtpnhvaiiidghrkwaksrgvtvqeghqtgvnnwkhiisrasqlgiklltiwalspq
    nfnrskmevdflmriyedflrsdvkelvtsqqdiqfsaigdksrlpeylqdaisyaegls
    qankgmhfilavayggrediveaarkiaakvehgilrpddideatfeqhlmtnitkfpsp
    dlliraageqrlsnfflwqlpftefyftpklfpdfgeadlldalasyrcryrgfge