PDB entry 5hc4

View 5hc4 on RCSB PDB site
Description: structure of esterase est22
Deposited on 2016-01-04, released 2017-01-18
The last revision was dated 2017-01-18, with a file datestamp of 2017-01-13.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: lipolytic enzyme
    Species: Uncultured bacterium [TaxId:77133]
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: lipolytic enzyme
    Species: Uncultured bacterium [TaxId:77133]
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: lipolytic enzyme
    Species: Uncultured bacterium [TaxId:77133]
    Database cross-references and differences (RAF-indexed):
  • Chain 'D':
    Compound: lipolytic enzyme
    Species: Uncultured bacterium [TaxId:77133]
    Database cross-references and differences (RAF-indexed):
  • Heterogens: GOL, TRS, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >5hc4A (A:)
    mgsshhhhhhhssglvprgshmtnkiaedpridprikaifsgmdlggggdvesreamlea
    asseeatavrdglrvfldacdneeiapsaglkiedyeftsepdgniakiqyirpdstdkl
    pcvyyihgggmqslscyygnyrawgkiiasngvavamvefrnalvpsalpevapypagln
    dcvsgvkwvashadelgidasriiiagesgggnltlaaglrlkqegsqdliqglyalcpy
    iagswpsedspsstenngilldlhnnqgamgygieayemrdplawpgfateedvsglvpt
    fisvnecdplrdeginfyrlllragvsakcrqvmgtihgteifpiacpdvsrdtaasian
    fckgg
    

    Sequence, based on observed residues (ATOM records):
    >5hc4A (A:)
    kiaedpridprikaifsgmdlggggdvesreamleaasseeatavrdglrvfldacdnee
    iapsaglkiedyeftsepdgniakiqyirpdstdklpcvyyihgggmqslscyygnyraw
    gkiiasngvavamvefrnalvpsalpevapypaglndcvsgvkwvashadelgidasrii
    iagesgggnltlaaglrlkqegsqdliqglyalcpyiagswpsedspsstenngilldlh
    nnqgamgygieayemrdplawpgfateedvsglvptfisvnecdplrdeginfyrlllra
    gvsakcrqvmgtihgteifpiacpdvsrdtaasianfckgg
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >5hc4B (B:)
    mgsshhhhhhhssglvprgshmtnkiaedpridprikaifsgmdlggggdvesreamlea
    asseeatavrdglrvfldacdneeiapsaglkiedyeftsepdgniakiqyirpdstdkl
    pcvyyihgggmqslscyygnyrawgkiiasngvavamvefrnalvpsalpevapypagln
    dcvsgvkwvashadelgidasriiiagesgggnltlaaglrlkqegsqdliqglyalcpy
    iagswpsedspsstenngilldlhnnqgamgygieayemrdplawpgfateedvsglvpt
    fisvnecdplrdeginfyrlllragvsakcrqvmgtihgteifpiacpdvsrdtaasian
    fckgg
    

    Sequence, based on observed residues (ATOM records):
    >5hc4B (B:)
    kiaedpridprikaifsgmdlggggdvesreamleaasseeatavrdglrvfldacdnee
    iapsaglkiedyeftsepdgniakiqyirpdstdklpcvyyihgggmqslscyygnyraw
    gkiiasngvavamvefrnalvpsalpevapypaglndcvsgvkwvashadelgidasrii
    iagesgggnltlaaglrlkqegsqdliqglyalcpyiagswpsedspsstenngilldlh
    nnqgamgygieayemrdplawpgfateedvsglvptfisvnecdplrdeginfyrlllra
    gvsakcrqvmgtihgteifpiacpdvsrdtaasianfckgg
    

  • Chain 'C':
    Sequence, based on SEQRES records:
    >5hc4C (C:)
    mgsshhhhhhhssglvprgshmtnkiaedpridprikaifsgmdlggggdvesreamlea
    asseeatavrdglrvfldacdneeiapsaglkiedyeftsepdgniakiqyirpdstdkl
    pcvyyihgggmqslscyygnyrawgkiiasngvavamvefrnalvpsalpevapypagln
    dcvsgvkwvashadelgidasriiiagesgggnltlaaglrlkqegsqdliqglyalcpy
    iagswpsedspsstenngilldlhnnqgamgygieayemrdplawpgfateedvsglvpt
    fisvnecdplrdeginfyrlllragvsakcrqvmgtihgteifpiacpdvsrdtaasian
    fckgg
    

    Sequence, based on observed residues (ATOM records):
    >5hc4C (C:)
    nkiaedpridprikaifsgmdlggdvesreamleaasseeatavrdglrvfldacdneei
    apsaglkiedyeftsepdgniakiqyirpdstdklpcvyyihgggmqslscyygnyrawg
    kiiasngvavamvefrnalvpsalpevapypaglndcvsgvkwvashadelgidasriii
    agesgggnltlaaglrlkqegsqdliqglyalcpyiagswpsedspsstenngilldlhn
    nqgamgygieayemrdplawpgfateedvsglvptfisvnecdplrdeginfyrlllrag
    vsakcrqvmgtihgteifpiacpdvsrdtaasianfckgg
    

  • Chain 'D':
    Sequence, based on SEQRES records:
    >5hc4D (D:)
    mgsshhhhhhhssglvprgshmtnkiaedpridprikaifsgmdlggggdvesreamlea
    asseeatavrdglrvfldacdneeiapsaglkiedyeftsepdgniakiqyirpdstdkl
    pcvyyihgggmqslscyygnyrawgkiiasngvavamvefrnalvpsalpevapypagln
    dcvsgvkwvashadelgidasriiiagesgggnltlaaglrlkqegsqdliqglyalcpy
    iagswpsedspsstenngilldlhnnqgamgygieayemrdplawpgfateedvsglvpt
    fisvnecdplrdeginfyrlllragvsakcrqvmgtihgteifpiacpdvsrdtaasian
    fckgg
    

    Sequence, based on observed residues (ATOM records):
    >5hc4D (D:)
    nkiaedpridprikaifsgmdlggggdvesreamleaasseeatavrdglrvfldacdne
    eiapsaglkiedyeftsepdgniakiqyirpdstdklpcvyyihgggmqslscyygnyra
    wgkiiasngvavamvefrnalvpsalpevapypaglndcvsgvkwvashadelgidasri
    iiagesgggnltlaaglrlkqegsqdliqglyalcpyiagswpsedspsstenngilldl
    hnnqgamgygieayemrdplawpgfateedvsglvptfisvnecdplrdeginfyrlllr
    agvsakcrqvmgtihgteifpiacpdvsrdtaasianfckgg