PDB entry 5hc0

View 5hc0 on RCSB PDB site
Description: structure of esterase est22 with p-nitrophenol
Deposited on 2016-01-04, released 2017-01-18
The last revision was dated 2017-01-18, with a file datestamp of 2017-01-13.
Experiment type: XRAY
Resolution: 1.4 Å
R-factor: N/A
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: lipolytic enzyme
    Species: Uncultured bacterium [TaxId:77133]
    Database cross-references and differences (RAF-indexed):
  • Heterogens: GOL, NPO, ACY, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >5hc0A (A:)
    mgsshhhhhhhssglvprgshmtnkiaedpridprikaifsgmdlggggdvesreamlea
    asseeatavrdglrvfldacdneeiapsaglkiedyeftsepdgniakiqyirpdstdkl
    pcvyyihgggmqslscyygnyrawgkiiasngvavamvefrnalvpsalpevapypagln
    dcvsgvkwvashadelgidasriiiagesgggnltlaaglrlkqegsqdliqglyalcpy
    iagswpsedspsstenngilldlhnnqgamgygieayemrdplawpgfateedvsglvpt
    fisvnecdplrdeginfyrlllragvsakcrqvmgtihgteifpiacpdvsrdtaasian
    fckgg
    

    Sequence, based on observed residues (ATOM records):
    >5hc0A (A:)
    kiaedpridprikaifsgmgggdvesreamleaasseeatavrdglrvfldacdneeiap
    saglkiedyeftsepdgniakiqyirpdstdklpcvyyihgggmqslscyygnyrawgki
    iasngvavamvefrnalvpsalpevapypaglndcvsgvkwvashadelgidasriiiag
    esgggnltlaaglrlkqegsqdliqglyalcpyiagswpsedspsstenngilldlhnnq
    gamgygieayemrdplawpgfateedvsglvptfisvnecdplrdeginfyrlllragvs
    akcrqvmgtihgteifpiacpdvsrdtaasianfckgg