PDB entry 5hbz

View 5hbz on RCSB PDB site
Description: structure of eav nsp11 k170a mutant at 3.10a
Deposited on 2016-01-04, released 2016-10-12
The last revision was dated 2017-01-18, with a file datestamp of 2017-01-13.
Experiment type: XRAY
Resolution: 3.1 Å
R-factor: N/A
AEROSPACI score: 0.12 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Non-structural protein 11
    Species: Equine arteritis virus Bucyrus [TaxId:299386]
    Gene: rep, 1a-1b
    Database cross-references and differences (RAF-indexed):
    • Uniprot P19811 (2-220)
      • engineered mutation (171)
  • Chain 'B':
    Compound: Non-structural protein 11
    Species: Equine arteritis virus Bucyrus [TaxId:299386]
    Gene: rep, 1a-1b
    Database cross-references and differences (RAF-indexed):
    • Uniprot P19811 (2-220)
      • engineered mutation (171)
  • Chain 'C':
    Compound: Non-structural protein 11
    Species: Equine arteritis virus Bucyrus [TaxId:299386]
    Gene: rep, 1a-1b
    Database cross-references and differences (RAF-indexed):
    • Uniprot P19811 (2-220)
      • engineered mutation (171)
  • Chain 'D':
    Compound: Non-structural protein 11
    Species: Equine arteritis virus Bucyrus [TaxId:299386]
    Gene: rep, 1a-1b
    Database cross-references and differences (RAF-indexed):
  • Chain 'E':
    Compound: Non-structural protein 11
    Species: Equine arteritis virus Bucyrus [TaxId:299386]
    Gene: rep, 1a-1b
    Database cross-references and differences (RAF-indexed):
  • Chain 'F':
    Compound: Non-structural protein 11
    Species: Equine arteritis virus Bucyrus [TaxId:299386]
    Gene: rep, 1a-1b
    Database cross-references and differences (RAF-indexed):
    • Uniprot P19811 (2-220)
      • expression tag (0-1)

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >5hbzA (A:)
    essnkisclprvaqnlgyhyspdlpgfcpipkelaehwpvvsndrypnclqitlqqvcel
    skpcsagymvgqsvfvqtpgvtsywltewvdgkaralpdslfssgrfetnsrafldeaee
    kfaaahphaclgeinkstvggshfifsqylppllpadavalvgaslagkaaaaacsvvdv
    yapsfepylhpetlsrvykimidfkpcrlmvwrnatfyvqe
    

    Sequence, based on observed residues (ATOM records):
    >5hbzA (A:)
    snkisclprvaqnlgyhyspdlpgfcpipkelaehwpvvsndrypnclqitlqqvcelsk
    pcsagymvgqsvfvqtpgvtsywltewvdgkaralpdslfssgrfetnsrafldeaeekf
    aaahphaclgeinkstvggshfifsqylppllpadavalvgaslagkaaaaacsvvdvya
    psfepylhpetlsrvykimidfkpcrlmvwrnatfyvqe
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >5hbzB (B:)
    essnkisclprvaqnlgyhyspdlpgfcpipkelaehwpvvsndrypnclqitlqqvcel
    skpcsagymvgqsvfvqtpgvtsywltewvdgkaralpdslfssgrfetnsrafldeaee
    kfaaahphaclgeinkstvggshfifsqylppllpadavalvgaslagkaaaaacsvvdv
    yapsfepylhpetlsrvykimidfkpcrlmvwrnatfyvqe
    

    Sequence, based on observed residues (ATOM records):
    >5hbzB (B:)
    snkisclprvaqnlgyhyspdlpgfcpipkelaehwpvvsndrypnclqitlqqvcelsk
    pcsagymvgqsvfvqtpgvtsywltewvdgkaralpdslfssgrfetnsrafldeaeekf
    aaahphaclgeinkstvggshfifsqylppllpadavalvgaslagkaaaaacsvvdvya
    psfepylhpetlsrvykimidfkpcrlmvwrnatfyvqe
    

  • Chain 'C':
    Sequence, based on SEQRES records:
    >5hbzC (C:)
    essnkisclprvaqnlgyhyspdlpgfcpipkelaehwpvvsndrypnclqitlqqvcel
    skpcsagymvgqsvfvqtpgvtsywltewvdgkaralpdslfssgrfetnsrafldeaee
    kfaaahphaclgeinkstvggshfifsqylppllpadavalvgaslagkaaaaacsvvdv
    yapsfepylhpetlsrvykimidfkpcrlmvwrnatfyvqe
    

    Sequence, based on observed residues (ATOM records):
    >5hbzC (C:)
    snkisclprvaqnlgyhyspdlpgfcpipkelaehwpvvsndrypnclqitlqqvcelsk
    pcsagymvgqsvfvqtpgvtsywltewvdgkaralpdslfssgrfetnsrafldeaeekf
    aaahphaclgeinkstvggshfifsqylppllpadavalvgaslagkaaaaacsvvdvya
    psfepylhpetlsrvykimidfkpcrlmvwrnatfyvqe
    

  • Chain 'D':
    Sequence, based on SEQRES records:
    >5hbzD (D:)
    essnkisclprvaqnlgyhyspdlpgfcpipkelaehwpvvsndrypnclqitlqqvcel
    skpcsagymvgqsvfvqtpgvtsywltewvdgkaralpdslfssgrfetnsrafldeaee
    kfaaahphaclgeinkstvggshfifsqylppllpadavalvgaslagkaaaaacsvvdv
    yapsfepylhpetlsrvykimidfkpcrlmvwrnatfyvqe
    

    Sequence, based on observed residues (ATOM records):
    >5hbzD (D:)
    snkisclprvaqnlgyhyspdlpgfcpipkelaehwpvvsndrypnclqitlqqvcelsk
    pcsagymvgqsvfvqtpgvtsywltewvdgkaralpdslfssgrfetnsrafldeaeekf
    aaahphaclgeinkstvggshfifsqylppllpadavalvgacsvvdvyapsfepylhpe
    tlsrvykimidfkpcrlmvwrnatfyvqe
    

  • Chain 'E':
    Sequence, based on SEQRES records:
    >5hbzE (E:)
    essnkisclprvaqnlgyhyspdlpgfcpipkelaehwpvvsndrypnclqitlqqvcel
    skpcsagymvgqsvfvqtpgvtsywltewvdgkaralpdslfssgrfetnsrafldeaee
    kfaaahphaclgeinkstvggshfifsqylppllpadavalvgaslagkaaaaacsvvdv
    yapsfepylhpetlsrvykimidfkpcrlmvwrnatfyvqe
    

    Sequence, based on observed residues (ATOM records):
    >5hbzE (E:)
    snkisclprvaqnlgyhyspdlpgfcpipkelaehwpvvsndrypnclqitlqqvcelsk
    pcsagymvgqsvfvqtpgvtsywltewvdgkaralpdslfssgrfetnsrafldeaeekf
    aaahphaclgeinkstvggshfifsqylppllpadavalvgacsvvdvyapsfepylhpe
    tlsrvykimidfkpcrlmvwrnatfyvqe
    

  • Chain 'F':
    Sequence, based on SEQRES records:
    >5hbzF (F:)
    essnkisclprvaqnlgyhyspdlpgfcpipkelaehwpvvsndrypnclqitlqqvcel
    skpcsagymvgqsvfvqtpgvtsywltewvdgkaralpdslfssgrfetnsrafldeaee
    kfaaahphaclgeinkstvggshfifsqylppllpadavalvgaslagkaaaaacsvvdv
    yapsfepylhpetlsrvykimidfkpcrlmvwrnatfyvqe
    

    Sequence, based on observed residues (ATOM records):
    >5hbzF (F:)
    essnkisclprvaqnlgyhyspdlpgfcpipkelaehwpvvsndrypnclqitlqqvcel
    skpcsagymvgqsvfvqtpgvtsywltewvdgkaralpdslfssgrfetnsrafldeaee
    kfaaahphaclgeinkstvggshfifsqylppllpadavalvgacsvvdvyapsfepylh
    petlsrvykimidfkpcrlmvwrnatfyvqe