PDB entry 5hbv

View 5hbv on RCSB PDB site
Description: Complex structure of Fab35 and mouse nAChR alpha1
Class: transport protein/toxin
Keywords: Nicotinic acetylcholine receptor alpha1, Fab35, Complex, Myasthenia gravis, TRANSPORT PROTEIN-TOXIN complex
Deposited on 2016-01-02, released 2017-05-03
The last revision prior to the SCOPe 2.06 freeze date was dated 2017-05-03, with a file datestamp of 2017-04-28.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: N/A
AEROSPACI score: 0.17 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: alpha-bungarotoxin isoform v31
    Species: Bungarus multicinctus [TaxId:8616]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5hbva_
  • Chain 'B':
    Compound: Acetylcholine receptor subunit alpha 1
    Species: Mus musculus [TaxId:10090]
    Gene: Chrna1, Acra
    Database cross-references and differences (RAF-indexed):
    • Uniprot P04756 (2-211)
      • expression tag (0-1)
      • engineered mutation (8)
      • engineered mutation (149)
      • engineered mutation (155)
    Domains in SCOPe 2.06: d5hbvb1, d5hbvb2
  • Chain 'C':
    Compound: Fab35, Light Chain
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed):
    • PDB 5HBV (0-End)
    Domains in SCOPe 2.06: d5hbvc1, d5hbvc2
  • Chain 'D':
    Compound: Fab35, Heavy Chain
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed):
    • PDB 5HBV (0-218)
  • Heterogens: NAG, BMA, MAN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5hbvA (A:)
    ivchttatspisavtcppgenlcyrkmwcdvfcssrgkvvelgcaatcpskkpyeevtcc
    stdkcnphpkqrpg
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5hbvB (B:)
    ksehetrleaklfedyssvvrpvedhreivqvtvglqliqlinvdevnqivttnvrlkqq
    wvdynlkwnpddyggvkkihipsekiwrpdvvlynnadgdfaivkftkvlldytghitwt
    ppaifksyceiivthfpfdeqncsmklgtrtydgsavainpesdqpdlsnfmesgewvik
    eargwkhwvfysccpttpyldityhfvmqrlp
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5hbvC (C:)
    divitqspsllsasvgdrvtltckgsqnidnylawyqqklgeapklliyktnslqtgips
    rfsgsgsgtdytltisslhsedlatyycyqyingytfgtgtklelkradaaptvsifpps
    teqlatggasvvclmnnfyprdisvkwkidgterrdgvldsvtdqdskdstysmsstlsl
    tkadyeshnlytcevvhktssspvvksfnrnec
    

    Sequence, based on observed residues (ATOM records): (download)
    >5hbvC (C:)
    divitqspsllsasvgdrvtltckgsqnidnylawyqqklgeapklliyktnslqtgips
    rfsgsgsgtdytltisslhsedlatyycyqyingytfgtgtklelkradaaptvsifpps
    teqlatggasvvclmnnfyprdisvkwkidgterrdgvldsvtdqdskdstysmsstlsl
    tkadyeshnlytcevvhktssspvvksfnrn
    

  • Chain 'D':
    No sequence available.