PDB entry 5hbl

View 5hbl on RCSB PDB site
Description: native rhodanese domain of ygap prepared with 1mm ddt is s- nitrosylated
Deposited on 2015-12-31, released 2016-08-10
The last revision was dated 2016-09-28, with a file datestamp of 2016-09-23.
Experiment type: XRAY
Resolution: 1.62 Å
R-factor: N/A
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Inner membrane protein YgaP
    Species: Escherichia coli [TaxId:562]
    Gene: ygaP, b2668, JW2643
    Database cross-references and differences (RAF-indexed):
    • Uniprot P55734
      • microheterogeneity (81)
  • Heterogens: HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >5hblA (A:)
    mksshhhhhhenlyfqsnaalttisphdaqeliargaklidirdadeylrehipeadlap
    lsvleqsglpaklrheqiifhcqagkrtsnnadklaaiaapaeiflledgidgwkkaglp
    vavnksq
    

    Sequence, based on observed residues (ATOM records):
    >5hblA (A:)
    ttisphdaqeliargaklidirdadeylrehipeadlaplsvleqsglpaklrheqiifh
    cqagkrtsnnadklaaiaapaeiflledgidgwkkaglpvavnks