PDB entry 5hb5

View 5hb5 on RCSB PDB site
Description: crystal structure of chaetomium thermophilum nup145n apd
Deposited on 2015-12-31, released 2016-04-20
The last revision was dated 2019-12-25, with a file datestamp of 2019-12-20.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: N/A
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Nucleoporin NUP145
    Species: Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719) [TaxId:759272]
    Gene: NUP145, CTHT_0042590
    Database cross-references and differences (RAF-indexed):
    • Uniprot G0SAK3 (4-139)
      • expression tag (1-3)
  • Chain 'B':
    Compound: Nucleoporin NUP145
    Species: Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719) [TaxId:759272]
    Gene: NUP145, CTHT_0042590
    Database cross-references and differences (RAF-indexed):
    • Uniprot G0SAK3 (4-139)
      • expression tag (0-3)
  • Heterogens: FLC, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >5hb5A (A:)
    gphmgaywmsptaddiramnrmqrqrvvgftvgrenvgsvqfkvpvdlsninlddlfgti
    vileprsatvypnaakkppmgkglnvpalislehswprggptikgrrlerhierlksipd
    ttfesydpetgvwafsvehf
    

    Sequence, based on observed residues (ATOM records):
    >5hb5A (A:)
    phmgaywmsptaddiramnrmqrqrvvgftvgrenvgsvqfkvpvdlsninlddlfgtiv
    ileprsatvypnaakkppmgkglnvpalislehswprggptikgrrlerhierlksipdt
    tfesydpetgvwafsvehf
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records:
    >5hb5B (B:)
    gphmgaywmsptaddiramnrmqrqrvvgftvgrenvgsvqfkvpvdlsninlddlfgti
    vileprsatvypnaakkppmgkglnvpalislehswprggptikgrrlerhierlksipd
    ttfesydpetgvwafsvehf