PDB entry 5hav

View 5hav on RCSB PDB site
Description: Sperm whale myoglobin mutant L29H F33Y F43H (F33Y CuBMb) with oxygen bound
Class: oxidoreductase
Keywords: oxidase, OXIDOREDUCTASE
Deposited on 2015-12-31, released 2016-01-13
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-09-20, with a file datestamp of 2017-09-15.
Experiment type: XRAY
Resolution: 1.27 Å
R-factor: N/A
AEROSPACI score: 0.61 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Myoglobin
    Species: Physeter catodon [TaxId:9755]
    Gene: MB
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02185 (0-152)
      • engineered mutation (28)
      • engineered mutation (32)
      • engineered mutation (42)
    Domains in SCOPe 2.07: d5hava_
  • Heterogens: HEM, OXY, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >5havA (A:)
vlsegewqlvlhvwakveadvaghgqdihirlykshpetlekhdrfkhlkteaemkased
lkkhgvtvltalgailkkkghheaelkplaqshatkhkipikylefiseaiihvlhsrhp
gdfgadaqgamnkalelfrkdiaakykelgyqg