PDB entry 5hap

View 5hap on RCSB PDB site
Description: OXA-48 beta-lactamase - S70A mutant
Class: hydrolase
Keywords: hydrolase, serine beta-lactamase
Deposited on 2015-12-30, released 2016-09-07
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-09-13, with a file datestamp of 2017-09-08.
Experiment type: XRAY
Resolution: 1.89 Å
R-factor: N/A
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Beta-lactamase
    Species: Klebsiella pneumoniae [TaxId:573]
    Gene: bla OXA-48, blaOXA-48, KPE71T_00045
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q6XEC0 (0-240)
      • engineered mutation (45)
    Domains in SCOPe 2.07: d5hapa_
  • Chain 'B':
    Compound: Beta-lactamase
    Species: Klebsiella pneumoniae [TaxId:573]
    Gene: bla OXA-48, blaOXA-48, KPE71T_00045
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q6XEC0 (0-240)
      • engineered mutation (45)
    Domains in SCOPe 2.07: d5hapb_
  • Heterogens: CL, 1PE, PGE, NA, PEG, MPD, PG4, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5hapA (A:)
    wqenkswnahftehksqgvvvlwnenkqqgftnnlkranqaflpaatfkipnslialdlg
    vvkdehqvfkwdgqtrdiatwnrdhnlitamkysvvpvyqefarqigearmskmlhafdy
    gnedisgnvdsfwldggirisateqisflrklyhnklhvsersqrivkqamlteangdyi
    iraktgystriepkigwwvgwvelddnvwffamnmdmptsdglglrqaitkevlkqekii
    p
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5hapB (B:)
    wqenkswnahftehksqgvvvlwnenkqqgftnnlkranqaflpaatfkipnslialdlg
    vvkdehqvfkwdgqtrdiatwnrdhnlitamkysvvpvyqefarqigearmskmlhafdy
    gnedisgnvdsfwldggirisateqisflrklyhnklhvsersqrivkqamlteangdyi
    iraktgystriepkigwwvgwvelddnvwffamnmdmptsdglglrqaitkevlkqekii
    p