PDB entry 5ham

View 5ham on RCSB PDB site
Description: structure of rickettsia bellii effector protein rickce
Deposited on 2015-12-30, released 2016-07-27
The last revision was dated 2017-09-13, with a file datestamp of 2017-09-08.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: N/A
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: RickCE
    Species: Rickettsia bellii [TaxId:33990]
    Gene: RBE_0198
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: RickCE
    Species: Rickettsia bellii [TaxId:33990]
    Gene: RBE_0198
    Database cross-references and differences (RAF-indexed):
  • Heterogens: HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >5hamA (A:)
    gpeikdywyteneithlltaqldekkfsvqpaitfrntalteemlkdytakgeeknkila
    evqetikianlipdkeeralmlgdakkreeilklsdaereklkndllrggeaqqqinedi
    lnratkdikdngkeaavipiemgyghwtvlvakydkkdnqiiltfndslgnsinydgqkl
    pklidktlgnlpnkpiiideqtkqqtdqsacgvftvdngikiakgqailsteeskgekgl
    rlrehhaqiltdamfkqdaqwirqqmktnnnapd
    

    Sequence, based on observed residues (ATOM records):
    >5hamA (A:)
    dywyteneithlltaqldekkfsvqpaitfrntalteemlkdytakgeeknkilaevqet
    ikianlipdkeeralmlgdakkreeilklsdaereklkndllrggeaqqqinedilnrat
    kdikdngkeaavipiemgyghwtvlvakydkkdnqiiltfndslgnsinydgqklpklid
    ktlgnlpnkpiiideqtkqqtdqsacgvftvdngikiakgqailsteeskgekglrlreh
    haqiltdamfkqdaqwirqq
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >5hamB (B:)
    gpeikdywyteneithlltaqldekkfsvqpaitfrntalteemlkdytakgeeknkila
    evqetikianlipdkeeralmlgdakkreeilklsdaereklkndllrggeaqqqinedi
    lnratkdikdngkeaavipiemgyghwtvlvakydkkdnqiiltfndslgnsinydgqkl
    pklidktlgnlpnkpiiideqtkqqtdqsacgvftvdngikiakgqailsteeskgekgl
    rlrehhaqiltdamfkqdaqwirqqmktnnnapd
    

    Sequence, based on observed residues (ATOM records):
    >5hamB (B:)
    dywyteneithlltaqldekkfsvqpaitfrntalteemlkdytakgeeknkilaevqet
    ikianlipdkeeralmlgdakkreeilklsdaereklkndllrggeaqqqinedilnrat
    kdikdngkeaavipiemgyghwtvlvakydkkdnqiiltfndslgnsinydgqklpklid
    ktlgnlpnkpiiideqtkqqtdqsacgvftvdngikiakgqailsteeskgekglrlreh
    haqiltdamfkqdaqwirqq