PDB entry 5hag

View 5hag on RCSB PDB site
Description: structure of chlamydia trachomatis effector protein chladub1
Deposited on 2015-12-30, released 2016-07-27
The last revision was dated 2017-09-13, with a file datestamp of 2017-09-08.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: N/A
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Deubiquitinase and deneddylase Dub1
    Species: Chlamydia trachomatis [TaxId:813]
    Gene: cdu1, CTL0247
    Database cross-references and differences (RAF-indexed):
  • Heterogens: GOL, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >5hagA (A:)
    gpvktqedllplvpeqvfvemyedmarrqtiealvpawdsdiifkclcyfhtlypglipl
    etfppatifnfkqkiisiledkkavlrgepikgplpiccskenyrrhlqrttllpvfmwy
    hptpktlsdtmqtmkqlaikgsvgashwllvivdiqarrlvyfdslynyvmppenmkkel
    qsfaqqldqvypaydskkfsvkiaakeviqrgsgsscgawccqflhwylkdpltdalndl
    pvdsverhenlasfvqaceaavqdlpelswpea
    

    Sequence, based on observed residues (ATOM records):
    >5hagA (A:)
    dllplvpeqvfvemyedmarrqtiealvpawdsdiifkclcyfhtlypglipletfppat
    ifnfkqkiisiledkkavlrgepikgplpiccskenyrrhlqrttllpvfmwyhptpktl
    sdtmqtmkqlaikgsvgashwllvivdiqarrlvyfdslynyvmppenmkkelqsfaqql
    dqvypaydskkfsvkiaakeviqrgsgsscgawccqflhwylkdpltdalndlpvdsver
    henlasfvqaceaavqdlpelswpea