PDB entry 5haa

View 5haa on RCSB PDB site
Description: crystal structure of mpy-rnase j, an archaeal rnase j from methanolobus psychrophilus r15
Deposited on 2015-12-30, released 2017-01-04
The last revision was dated 2017-01-04, with a file datestamp of 2016-12-30.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: N/A
AEROSPACI score: 0.14 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ribonuclease j
    Species: Methanolobus psychrophilus R15 [TaxId:1094980]
    Gene: rnj, Mpsy_0886
    Database cross-references and differences (RAF-indexed):
    • Uniprot K4MAF9 (23-End)
      • expression tag (22)
  • Chain 'B':
    Compound: ribonuclease j
    Species: Methanolobus psychrophilus R15 [TaxId:1094980]
    Gene: rnj, Mpsy_0886
    Database cross-references and differences (RAF-indexed):
    • Uniprot K4MAF9 (23-469)
      • expression tag (8-19)
      • expression tag (22)
  • Heterogens: ZN, SO4, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >5haaA (A:)
    mgsshhhhhhssglvprgshmasteigiiavggynemgrnmtairvnediiiidmgirld
    rvqihedvdtdrmhsleliemgaipddtimnevngnvraivcthghldhigaipklahry
    aapiiatpyttalikhqidserkfgvknnivalkagetleitkditiefintqhsiidtv
    fvaihtpsgavvyacdfkfdrtptlgevpdfdrlkelgkegvialitestnagrngktps
    eliahmmlkdvllgteesavgmivttfashiarvnsivqfaqemgripvllgrsmeryvg
    tayqlgyidlpenveiygsrrdidnalkkimeagkdkylpvmtghqgepgavlgriange
    tpfkvetgdriifsanvipnpmtqanryaletklkmkgariydnvhvsghayredhwell
    rmlkpehvipahgtiqmhseyiqmaedagyslgdtlhllrngeelyieed
    

    Sequence, based on observed residues (ATOM records):
    >5haaA (A:)
    steigiiavggynemgrnmtairvnediiiidmgirldrvqihedvdtdrmhsleliemg
    aipddtimnevngnvraivcthghldhigaipklahryaapiiatpyttalikhqidser
    kfgvknnivalkagetleitkditiefintqhsiidtvfvaihtpsgavvyacdfkfdrt
    ptlgevpdfdrlkelgkegvialitestnagrngktpseliahmmlkdvllgteesavgm
    ivttfashiarvnsivqfaqemgripvllgrsmeryvgtayqlgyidlpenveiygsrrd
    idnalkkimeagkdkylpvmtghqgepgavlgriangetpfkvetgdriifsanvipnpm
    tqanryaletklkmkgariydnvhvsghayredhwellrmlkpehvipahgtiqmhseyi
    qmaedagyslgdtlhllrngeelyiee
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >5haaB (B:)
    mgsshhhhhhssglvprgshmasteigiiavggynemgrnmtairvnediiiidmgirld
    rvqihedvdtdrmhsleliemgaipddtimnevngnvraivcthghldhigaipklahry
    aapiiatpyttalikhqidserkfgvknnivalkagetleitkditiefintqhsiidtv
    fvaihtpsgavvyacdfkfdrtptlgevpdfdrlkelgkegvialitestnagrngktps
    eliahmmlkdvllgteesavgmivttfashiarvnsivqfaqemgripvllgrsmeryvg
    tayqlgyidlpenveiygsrrdidnalkkimeagkdkylpvmtghqgepgavlgriange
    tpfkvetgdriifsanvipnpmtqanryaletklkmkgariydnvhvsghayredhwell
    rmlkpehvipahgtiqmhseyiqmaedagyslgdtlhllrngeelyieed
    

    Sequence, based on observed residues (ATOM records):
    >5haaB (B:)
    hhssglvprgshsteigiiavggynemgrnmtairvnediiiidmgirldrvqihedvdt
    drmhsleliemgaipddtimnevngnvraivcthghldhigaipklahryaapiiatpyt
    talikhqidserkfgvknnivalkagetleitkditiefintqhsiidtvfvaihtpsga
    vvyacdfkfdrtptlgevpdfdrlkelgkegvialitestnagrngktpseliahmmlkd
    vllgteesavgmivttfashiarvnsivqfaqemgripvllgrsmeryvgtayqlgyidl
    penveiygsrrdidnalkkimeagkdkylpvmtghqgepgavlgriangetpfkvetgdr
    iifsanvipnpmtqanryaletklkmkgariydnvhvsghayredhwellrmlkpehvip
    ahgtiqmhseyiqmaedagyslgdtlhllrngeelyieed