PDB entry 5h9q

View 5h9q on RCSB PDB site
Description: Crystal Structure of Human Galectin-7 in Complex with TD139
Class: sugar binding protein
Keywords: galectin, thio-digalactoside (TD139), pi-arginine interaction, fluorine bonding, SUGAR BINDING PROTEIN
Deposited on 2015-12-29, released 2016-06-29
The last revision prior to the SCOPe 2.06 freeze date was dated 2016-06-29, with a file datestamp of 2016-06-24.
Experiment type: XRAY
Resolution: 1.93 Å
R-factor: N/A
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: galectin-7
    Species: Homo sapiens [TaxId:9606]
    Gene: LGALS7, PIG1, LGALS7B
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5h9qa_
  • Chain 'B':
    Compound: galectin-7
    Species: Homo sapiens [TaxId:9606]
    Gene: LGALS7, PIG1, LGALS7B
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5h9qb_
  • Heterogens: TD2, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5h9qA (A:)
    gsshhhhhhssglvprgshmsnvphksslpegirpgtvlrirglvppnasrfhvnllcge
    eqgsdaalhfnprldtsevvfnskeqgswgreergpgvpfqrgqpfevliiasddgfkav
    vgdaqyhhfrhrlplarvrlvevggdvqldsvrif
    

    Sequence, based on observed residues (ATOM records): (download)
    >5h9qA (A:)
    msnvphksslpegirpgtvlrirglvppnasrfhvnllcgeeqgsdaalhfnprldtsev
    vfnskeqgswgreergpgvpfqrgqpfevliiasddgfkavvgdaqyhhfrhrlplarvr
    lvevggdvqldsvrif
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5h9qB (B:)
    gsshhhhhhssglvprgshmsnvphksslpegirpgtvlrirglvppnasrfhvnllcge
    eqgsdaalhfnprldtsevvfnskeqgswgreergpgvpfqrgqpfevliiasddgfkav
    vgdaqyhhfrhrlplarvrlvevggdvqldsvrif
    

    Sequence, based on observed residues (ATOM records): (download)
    >5h9qB (B:)
    phksslpegirpgtvlrirglvppnasrfhvnllcgeeqgsdaalhfnprldtsevvfns
    keqgswgreergpgvpfqrgqpfevliiasddgfkavvgdaqyhhfrhrlplarvrlvev
    ggdvqldsvrif